Details for Lyrate rockcress Locus 16059316

Position : sca3 ( 5`- 3731049 .. 3730202 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059316

Protein [Map View]
MRSGEKKMDSVLINENPIIYPKRPRRVRTDQSNTDEFSSTNRIRDIRDPEHPKLSLEDLNILTEESVEVDDDKSYVRITF
TPTLPHCHLPTPIGLCLLAKLAQSLPARFKVDVRVAPGSHDKEKTVNKQLGDKERVAAGLENPDLVALLNKMMQV*

DNA
ATGCGTTCAGGAGAGAAAAAAATGGATTCTGTATTAATCAATGAGAACCCAATTATTTATCCGAAGAGACCAAGGCGTGT
TCGTACTGATCAGAGCAATACCGATGAGTTTTCATCTACAAATCGTATAAGAGATATCAGAGATCCAGAGCATCCTAAGC
TTTCTTTAGAAGACCTCAATATTCTTACAGAAGAATCAGTTGAAGTTGATGATGACAAGAGTTACGTTAGAATTACATTC
ACTCCAACTCTTCCGCACTGTCACTTGCCAACCCCTATTGGTCTTTGCCTCTTAGCAAAACTTGCACAAAGCCTACCTGC
TAGATTCAAGGTTGATGTGAGAGTAGCACCAGGGAGTCATGATAAAGAGAAGACAGTCAATAAACAACTTGGGGATAAAG
AACGTGTGGCTGCAGGATTAGAGAATCCTGACTTGGTGGCTCTGCTTAATAAAATGATGCAAGTTTGA