Details for Lyrate rockcress Locus 16059309

Position : sca3 ( 5`- 8500930 .. 8500748 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059309

Protein [Map View]
MGLQLESLMETIKSKVSLLRKKKKPYIKMDKSSSVRVAIRRKKTRDLIDKTLKVADRPGKR

DNA
ATGGGATTACAGTTGGAGAGTTTGATGGAGACGATAAAGTCAAAGGTGAGTTTGCTAAGGAAGAAGAAGAAACCTTACAT
CAAAATGGATAAAAGCTCCAGCGTTAGAGTTGCGATCCGTCGTAAGAAGACTAGAGATCTCATCGATAAGACCTTGAAGG
TTGCTGATCGTCCTGGCAAACGA