Details for Lyrate rockcress Locus 16059302

Position : sca3 ( 5`- 7304448 .. 7303554 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318477 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059302

Protein [Map View]
MAMMVGVAMGNIALGAETLGQINEAYKTKPMLKKPLDECSLRYKTIVDVDVHTAIIAVKGNPKFAEGAIVDAGVEASICE
GGFTKGQSTLTSLTQRMEKICDVTRAIVRILL*

DNA
ATGGCTATGATGGTGGGAGTTGCGATGGGAAATATTGCGCTTGGGGCTGAAACGCTCGGGCAGATCAATGAGGCGTACAA
GACGAAACCTATGCTGAAAAAGCCATTAGACGAGTGTAGTTTGAGATACAAAACGATCGTAGACGTTGACGTCCACACTG
CCATTATAGCTGTCAAAGGAAACCCTAAGTTCGCTGAAGGGGCTATTGTCGACGCCGGCGTGGAAGCTTCCATTTGCGAA
GGAGGGTTTACCAAAGGCCAATCTACGTTGACCAGTTTGACTCAAAGAATGGAAAAGATTTGCGATGTGACCAGAGCCAT
CGTCCGAATTTTGCTCTAA