Details for Lyrate rockcress Locus 16059301

Position : sca3 ( 5`- 9606654 .. 9606295 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059301

Protein [Map View]
MGNCLRHDNAIAGKEKDDLEPEPLVKLLEEGKTSYNGEEESERSTEEVSKVIRIKVVVTKKELRQILGHKNGINSIEQLV
HVLKDSGRNISRANYEEDEKEEGNENWRPSLESIPESHY*

DNA
ATGGGGAATTGTCTGCGACACGACAATGCCATTGCCGGAAAAGAGAAAGACGATCTCGAGCCCGAGCCGCTGGTTAAGTT
ATTGGAAGAAGGCAAAACGAGTTACAATGGTGAAGAAGAAAGTGAAAGATCAACGGAAGAAGTATCTAAGGTGATAAGGA
TTAAAGTTGTGGTGACAAAAAAAGAACTTAGACAAATCTTGGGTCACAAGAATGGTATCAACTCCATTGAACAGTTGGTT
CATGTTCTCAAAGATAGTGGCAGAAACATCTCCAGGGCTAATTATGAAGAAGATGAGAAAGAAGAAGGTAATGAAAATTG
GAGGCCTTCGTTAGAAAGCATTCCTGAGAGTCATTATTGA