Details for Lyrate rockcress Locus 16059285

Position : sca5 ( 5`- 17888634 .. 17891522 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_486071 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059285

Protein [Map View]
MKDSVLFLVGLFSLSVLVSQSISGRVKAPLLQSNTGGLVFSKSFNSIYDTSMYGRLQLNNGLARTPQMGWNSWNFFACNI
NETVIKETADALLSSGLADLGYIHVNIDDCWSNLLRDSKGQLVPHPETFPSGIKLLADYVHSKGLKLGIYSDAGVFTCQV
RPGSLFHEVDDADIFASWGVDYLKYDNCFNLGIKPIKRYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVGNSWRTTD
DINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGMTYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNK
EVIAVNQDPLGVQGRKIQANGEDDCQQVWSGPLSGDRIVVALWNRCSEQATITASWDVIGLESTISVSVRDLWQHKDVTE
NASGSFEAQVDAHDCHMYVLTPQTVSHSDV*

DNA
ATGAAAGATTCAGTATTGTTCCTCGTTGGGCTCTTCTCTTTATCTGTTTTGGTCTCTCAGTCGATCTCAGGGAGAGTCAA
AGCTCCATTGTTGCAGAGCAATACTGGTGGATTAGTTTTCAGCAAATCCTTCAATTCGATCTATGATACTTCTATGTACG
GACGCTTGCAGCTCAACAATGGCCTTGCTCGAACTCCTCAAATGGGATGGAATAGCTGGAATTTCTTTGCTTGCAATATC
AATGAAACAGTCATAAAGGAAACTGCTGATGCTTTACTTTCATCTGGATTGGCTGATTTGGGATACATACATGTCAATAT
TGATGATTGTTGGTCCAATTTGTTACGCGATTCAAAGGGTCAATTGGTTCCTCATCCTGAAACCTTCCCATCAGGAATTA
AGCTTCTTGCTGATTATGTTCATTCAAAGGGTCTCAAACTCGGTATATATTCTGATGCTGGCGTTTTCACGTGTCAAGTT
CGCCCGGGATCCCTTTTCCATGAAGTGGATGATGCTGACATATTTGCTTCTTGGGGTGTGGATTATCTGAAATATGACAA
CTGTTTCAACCTGGGAATAAAACCAATCAAAAGATACCCTCCAATGCGTGATGCTCTAAACGCAACTGGTCGCTCAATCT
TCTATTCACTTTGTGAATGGGGCGTTGATGATCCAGCCTTGTGGGCAAAAGAAGTTGGAAACAGTTGGCGCACAACCGAT
GACATCAACGATACATGGGCAAGTATGACTACAATTGCTGATTTGAATAACAAGTGGGCTGCATATGCTGGACCTGGTGG
TTGGAATGATCCGGATATGTTGGAAATTGGGAATGGAGGGATGACATACGAGGAGTATCGAGGTCATTTTAGCATTTGGG
CTTTGATGAAGGCACCCCTGTTGATTGGTTGTGATGTAAGAAACATGACCGCTGAAACTTTTGAGATTTTGAGTAATAAG
GAAGTTATCGCTGTAAACCAAGACCCACTTGGTGTTCAAGGAAGGAAAATTCAAGCCAATGGAGAAGATGATTGTCAGCA
GGTGTGGTCAGGACCTTTATCTGGTGACCGTATTGTAGTTGCTCTCTGGAACCGTTGCTCTGAGCAAGCAACCATTACAG
CATCATGGGATGTGATTGGTCTTGAATCTACCATTAGCGTCTCAGTAAGAGATTTGTGGCAGCACAAAGATGTTACAGAG
AACGCGTCTGGCTCCTTTGAAGCTCAAGTAGACGCACACGACTGTCATATGTACGTTCTCACTCCCCAGACAGTATCACA
CTCCGATGTATAG