Details for Lyrate rockcress Locus 16059268

Position : sca2 ( 5`- 16563018 .. 16561165 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059268

Protein [Map View]
MADTRNGKSLFFFFFVSLILLFLSPSFSDVTASESDPIPYENSDASPGVVTSSESDRQGVSLHRLVELVRNLTEVVARLD
AKLSETPFKVKKEISRDEIEEKAKAFSVTKYSPFWFERFDFTSAVKLDSEATCINVLPFRDHEGFSKYFAVGDSSGRVFV
FLRNGDVLVEFTTCDSPVTAMVSYMSVYKNESFVVTGHQSGVILLHRLREGSMGEDLNSAVMENVGKFDGTEDGLQVTVL
EVHHVGRVRYILATDLSGKLTVFTENRTVYGSVTPTSRPLVFLKQRLLFLTETGAGSLDLRSMKIRESECEGLNHSLARS
YVFDASERSKAYGFTSEGEIIHVLLLGDIMNFKCRVRSKKKVQMEEPVALQAIKGYLLVVNQEKVFVYNVSTQHYVRTTG
PRLLFPAALEDIRSTFLSHRESSKTTDHQKLEKVTPLIASDREKLLVMGLGDGYVATYKSKLPISKAEFNTMLWSSPVFF
FILFLFGAWHFFAKKKESLTAWGPDDPFTSTTMSSSSSTTTAQNSSAFGEPIRRNDDHLDLRRRYVSPSRYPPGAATGAY
RSVGSNDLSSRAPVETTNYRTTAQEMQYRGGSGLDSSGFGKRRESLFGNTKALDDES*

DNA
ATGGCGGATACTCGAAACGGCAAGTCCCTTTTCTTCTTTTTCTTTGTCTCGCTTATTTTGCTTTTCCTTTCGCCGTCTTT
TTCGGATGTCACAGCTTCCGAGTCCGATCCGATTCCGTACGAGAACTCAGATGCTTCTCCTGGAGTCGTGACCAGCAGTG
AATCCGACAGGCAAGGTGTTTCATTGCATAGACTAGTGGAACTTGTTAGGAATCTTACGGAAGTAGTTGCTAGATTAGAT
GCTAAGTTATCTGAAACTCCGTTTAAGGTAAAGAAAGAGATCAGTCGTGATGAGATCGAAGAGAAAGCTAAGGCTTTCTC
CGTGACAAAGTACAGTCCTTTCTGGTTTGAGAGATTCGATTTCACATCGGCTGTGAAACTAGACTCTGAAGCGACTTGTA
TCAACGTGTTGCCGTTTCGAGATCACGAAGGTTTTAGCAAGTATTTCGCAGTTGGGGATTCAAGTGGTAGGGTTTTTGTG
TTCTTGAGAAATGGGGATGTTTTGGTTGAGTTCACCACCTGCGATTCACCAGTCACGGCAATGGTGTCTTACATGTCTGT
GTATAAGAACGAGAGTTTCGTGGTGACGGGCCACCAAAGCGGAGTCATCTTGTTGCATAGACTCCGCGAGGGCTCGATGG
GGGAAGATTTGAATTCCGCTGTGATGGAAAATGTTGGCAAGTTTGATGGCACGGAGGATGGTTTGCAAGTGACTGTATTG
GAAGTGCATCATGTGGGTCGGGTTAGGTATATATTGGCGACGGATCTTAGCGGAAAGCTCACAGTTTTCACTGAGAACAG
AACGGTTTATGGCTCGGTTACCCCAACGAGTAGACCGCTCGTGTTCTTGAAGCAGAGGCTGTTGTTTCTCACCGAGACTG
GTGCTGGTTCGTTGGATTTAAGAAGCATGAAGATCAGAGAATCTGAGTGTGAAGGTCTTAACCATTCTCTAGCAAGAAGT
TATGTTTTTGATGCGTCGGAACGGTCTAAAGCTTACGGATTCACATCTGAAGGCGAAATCATTCACGTATTGCTTCTCGG
AGACATCATGAACTTCAAATGTAGAGTGAGATCAAAGAAGAAGGTTCAAATGGAGGAGCCTGTAGCCTTACAAGCCATCA
AAGGCTATCTTCTTGTAGTCAACCAAGAAAAAGTCTTTGTATACAACGTATCGACTCAACACTACGTTCGAACCACGGGT
CCTCGGCTTCTTTTCCCGGCTGCATTAGAAGATATCAGGTCAACGTTCTTGAGCCATCGAGAATCATCTAAAACCACTGA
TCACCAGAAGCTAGAAAAGGTAACTCCTCTGATAGCAAGCGACCGCGAAAAGCTGCTTGTGATGGGTTTAGGAGACGGAT
ACGTCGCTACATACAAATCAAAGCTTCCGATCTCCAAAGCAGAGTTCAACACAATGCTTTGGAGCAGTCCTGTCTTCTTC
TTCATACTTTTCTTATTCGGCGCTTGGCATTTTTTCGCCAAGAAGAAAGAATCTCTCACAGCTTGGGGACCTGATGATCC
TTTCACCTCCACGACAATGTCTTCTTCTTCTTCTACTACAACTGCACAAAACAGTTCCGCATTTGGTGAACCAATTAGAA
GAAACGATGACCACCTGGATCTTCGAAGAAGGTACGTTTCGCCGTCTCGGTACCCTCCTGGAGCAGCAACAGGTGCATAC
CGATCAGTGGGGTCCAACGATCTGAGCTCAAGAGCTCCAGTGGAAACTACTAACTACAGAACAACCGCACAGGAGATGCA
GTATCGTGGTGGGTCAGGTCTTGATTCAAGTGGATTTGGTAAAAGAAGAGAGAGTTTGTTTGGTAATACCAAAGCTTTAG
ATGACGAAAGTTAG