Details for Lyrate rockcress Locus 16059266

Position : sca3 ( 5`- 4352043 .. 4349868 -3` )
Annotation : [B2G] alpha beta fold family protein
External links : CoGe
PGDD synteny : 16059266

Protein [Map View]
MNLNTKCIFFLNQPKQILSTFASLSSLNDKLSLDSSRTHFQMSHRISGQPSRRLVVSNAASSSPSLSGGFPDDGAQGKEE
MEAETEQDPMNLADPDSCFCEFQGVHIHHKVFDPQTLSDDVSTPSLHAQETPKTEFPMILLHGFGASVFSWNRVMKPLAR
LVRSKVLAFDRPAFGLTSRIFHPFSGTANDAKPLNPYSMVYSVLTTLYFIDFLAADKAILVGHSAGCPIAVDSYFEAPER
VAALILVAPAIFAPRPVATTDAGDNRGKEAPTTNFLGTLVELTKGVIRAILRVVTGMANMLNSLYKKALAAFLRSFLGVM
LVRMAINKFGVTAVRNAWYDSKQVTDHVVQGYTKPLRAKGWDKALVEFTVATLTDNNGSEKKPPLSKRLQEIKCPVLIVT
GDTDRIVPAWNAERLARAIPGSVFEVIKKCGHLPQEEKPDEFISIVAKFLGNAFGGSQQVDLKFQGIVS*

DNA
ATGAATTTAAACACCAAATGCATCTTCTTTTTGAACCAACCAAAGCAGATTCTCTCAACTTTCGCTTCCTTATCCTCTCT
CAACGACAAGCTTAGTTTAGATTCCTCACGAACCCATTTTCAGATGTCTCACCGGATCTCTGGCCAACCCTCTCGCCGTC
TCGTCGTCTCCAATGCTGCTTCTTCTTCTCCTTCTCTCTCTGGCGGCTTCCCAGATGATGGAGCTCAGGGTAAAGAGGAG
ATGGAAGCTGAAACAGAACAAGATCCTATGAACTTAGCTGATCCAGACAGCTGTTTCTGTGAGTTTCAAGGTGTTCATAT
ACACCACAAAGTGTTTGATCCACAGACACTCTCTGATGATGTTTCAACCCCAAGCCTCCATGCTCAAGAAACACCAAAAA
CCGAGTTTCCGATGATTCTATTGCACGGCTTTGGCGCTTCTGTGTTCTCCTGGAACAGAGTTATGAAGCCTCTGGCTCGG
CTCGTCCGTTCAAAAGTTCTGGCCTTTGATAGACCCGCATTTGGCTTGACTTCTCGGATTTTCCACCCGTTTAGTGGTAC
TGCCAATGATGCAAAACCATTGAATCCCTACTCTATGGTGTATTCCGTGCTCACTACGTTGTATTTCATCGATTTTCTTG
CTGCCGATAAGGCGATTCTTGTGGGACATTCTGCAGGTTGCCCTATAGCTGTAGATTCTTACTTTGAAGCCCCAGAGCGT
GTTGCTGCTCTCATTCTCGTCGCTCCAGCTATATTCGCTCCCCGTCCTGTGGCCACAACTGATGCTGGAGATAACCGTGG
CAAAGAAGCTCCAACAACCAACTTTCTAGGGACTCTAGTTGAGTTAACCAAAGGCGTTATAAGAGCAATTTTGAGAGTGG
TTACGGGAATGGCGAATATGCTGAATTCTCTCTACAAGAAAGCTTTAGCAGCTTTCCTCAGGTCCTTTCTTGGAGTAATG
CTGGTGAGGATGGCAATCAATAAATTTGGAGTAACAGCTGTTAGAAACGCATGGTATGACTCGAAACAAGTGACGGATCA
CGTCGTCCAGGGTTATACAAAGCCTCTAAGAGCCAAGGGATGGGACAAAGCTCTAGTGGAATTCACAGTCGCTACACTAA
CAGATAATAATGGCTCAGAGAAAAAACCCCCATTGTCGAAAAGACTCCAAGAAATCAAATGTCCGGTTCTGATTGTGACG
GGAGATACAGACCGGATTGTGCCAGCTTGGAACGCAGAGAGGCTGGCACGAGCCATACCGGGATCGGTGTTCGAAGTAAT
TAAGAAATGTGGTCATCTTCCTCAAGAGGAAAAGCCAGATGAGTTCATATCTATTGTTGCAAAGTTTCTAGGGAATGCTT
TTGGAGGGTCACAACAAGTGGACTTGAAGTTCCAAGGGATTGTATCATGA