Details for Lyrate rockcress Locus 16059262

Position : sca3 ( 5`- 9238132 .. 9236010 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479619 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059262

Protein [Map View]
MKKPVGAEKKRFKRSSGSASTSVRDSGSDAQPRKQAVKKDSFQLFAEKVRDHKGLESRWAVMEQARVEYFRGKDFVSFMK
NNPEFKEILEEDKDLDTDDIANVLLGKNLLVRCDRVTKTLRPGKKKLSTWPAHLEIFRDDQSFSENDAFFAWTFEKRHPL
WQTLLSFFWPVLTLAICLFPVYPHRCKLIVLYSCAGILLMILSLLFVRAVAFGAMWILLGKRVWFFPNILAEEATLKELF
RFWPKKDEEEPPKWTSRLFYTVVAIVVVMLLRRHAPDEAARARYQRRMSNIIDDVLEWSPKLALSGLMENQQPVNITDVA
NNSSDSAGSDQTEEVVLDETQGEDLEETQGEEEAEGWTDSDLKT*

DNA
ATGAAGAAGCCGGTCGGAGCCGAGAAGAAGAGGTTTAAACGATCATCGGGATCTGCATCTACCTCCGTTAGAGATTCTGG
TTCTGATGCTCAACCTAGGAAGCAAGCTGTGAAGAAGGATAGTTTTCAGTTGTTTGCTGAGAAAGTTAGAGACCACAAGG
GATTGGAATCTAGATGGGCTGTTATGGAGCAAGCACGAGTCGAATATTTCAGAGGGAAAGATTTTGTGAGCTTCATGAAG
AATAATCCTGAGTTTAAAGAGATTCTGGAAGAAGATAAAGACCTTGATACAGATGATATTGCCAATGTTTTGTTGGGAAA
GAACCTTTTGGTTCGCTGTGATCGTGTTACAAAAACTCTTCGACCCGGGAAGAAAAAGCTCTCTACTTGGCCAGCTCATT
TGGAGATTTTCCGTGATGATCAATCTTTCTCTGAAAATGATGCCTTTTTTGCATGGACGTTCGAAAAACGGCATCCTCTA
TGGCAAACACTTTTGTCCTTCTTCTGGCCTGTATTGACTCTTGCAATTTGTTTGTTTCCTGTGTACCCACACCGTTGCAA
ACTAATTGTACTCTACTCATGCGCGGGCATTCTTTTGATGATTCTCTCCTTGCTTTTCGTGAGAGCAGTTGCTTTCGGTG
CTATGTGGATTCTTTTGGGAAAGCGTGTCTGGTTCTTCCCCAACATTCTAGCCGAGGAAGCCACATTGAAGGAACTGTTC
CGTTTCTGGCCAAAGAAAGACGAGGAAGAACCGCCCAAGTGGACATCTCGACTTTTCTACACAGTAGTGGCTATTGTTGT
TGTCATGCTGCTTAGGCGCCATGCCCCTGATGAAGCTGCTCGGGCCAGGTACCAAAGAAGGATGTCCAACATCATTGATG
ATGTCCTTGAGTGGTCACCAAAGCTAGCACTTTCTGGTTTAATGGAGAATCAGCAACCTGTCAACATCACAGATGTGGCA
AACAACTCCTCAGATTCAGCAGGTTCCGACCAGACTGAAGAGGTCGTCCTAGACGAAACACAAGGCGAGGACCTAGAGGA
AACTCAAGGCGAGGAGGAAGCTGAAGGTTGGACTGACTCTGATCTAAAAACATAA