Details for Lyrate rockcress Locus 16059260

Position : sca3 ( 5`- 4876330 .. 4874671 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_317988 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059260

Protein [Map View]
MADKLVADKHVRYILMAEKKKESFESVVMDHLRMNGAYWGLTTLDLLDKLGSVSAVCGFAGNTGHDPHVIYTLSAVQILA
LFDKLSILDVQKVSSYIAGLQNKDGSFSGDMWGEVDTRFSYIAICCLSILKCLDKINVKKAVDYIVSCKNLDGGFGCTPG
AESHARQIFCCVGALAITGNLHHVDKDLLGWWLCERQDYESGGLNGRPEKLPDVCYSWWVLSSLIMIDRVHWIEKGKLVK
FILDCQDMDNGGISDNPKDAVDIFHTYFGVAGLSLLEYPGVKTIDPAYALPVHVINRILFTK*

DNA
ATGGCAGACAAGCTCGTAGCTGACAAGCATGTTCGTTACATTCTGATGGCAGAAAAGAAAAAAGAGAGTTTTGAGTCTGT
TGTGATGGATCACCTGAGAATGAATGGTGCATATTGGGGACTAACCACACTAGATTTACTCGACAAGCTTGGTTCTGTTT
CTGCGGTGTGTGGCTTTGCCGGTAATACTGGACATGATCCGCATGTTATATATACACTCAGTGCTGTACAAATCTTGGCC
CTCTTTGACAAACTAAGCATTCTTGATGTCCAAAAAGTGTCAAGTTATATTGCTGGGTTACAGAATAAAGATGGATCCTT
CTCAGGAGATATGTGGGGCGAAGTAGATACAAGGTTTTCGTACATAGCTATATGCTGTCTCTCAATATTAAAATGTCTTG
ATAAGATCAATGTGAAGAAGGCTGTTGATTACATTGTGAGCTGCAAAAACCTGGATGGTGGTTTCGGGTGCACACCTGGA
GCGGAGTCTCATGCAAGACAGATTTTCTGTTGCGTGGGTGCTCTTGCTATCACCGGGAATCTCCATCATGTTGATAAGGA
CTTACTTGGATGGTGGTTATGTGAAAGACAAGACTACGAGTCTGGAGGTTTAAATGGACGACCTGAGAAACTCCCTGATG
TTTGCTATTCTTGGTGGGTGTTATCCAGCTTAATCATGATCGACAGAGTTCATTGGATCGAGAAAGGAAAGCTTGTCAAG
TTCATCTTGGACTGTCAGGACATGGATAACGGAGGTATCTCAGATAATCCCAAAGATGCTGTTGATATCTTCCACACCTA
CTTTGGAGTTGCGGGGCTCTCTCTTCTCGAGTATCCTGGAGTCAAAACAATTGATCCTGCCTACGCTTTGCCTGTCCATG
TCATCAACCGGATTCTCTTCACCAAATGA