Details for Lyrate rockcress Locus 16059241

Position : sca2 ( 5`- 16567486 .. 16563725 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059241

Protein [Map View]
MMNDEQLSPIGESSVPVPNRMLRRLKKAKSISDLCPGSDGEDLGKSELQSGKGFDGFEEEDGVRSDLKGLGVEDEVTAKK
VLDFDSVPEFNQTLEDLGDKAEEDGISDSETRDEIRAVETTEAGKERPISAPEFDGICDLDTEEEIRVSETTKEAGKKRS
IPETSDGEGKERKRDKKRNKKSDDFDELPVSTASMNMTKKERREYLDQLRAENQRLLRETRDAAFEPAPLVRKPISSVLE
KIRRRKEEISKQFLSRKKSKSIDICDEDDFEEVVAEEKNEESTSKQSHGGQHCSEDSAGPLENSDSPSYKKAESTPTHQD
PSLRPQTINSGDELLEKTSSRSLEEAMTPSVVAMNLKLNLSPVPDKSSEETEYRKENSDPETHDSSPGDPVRKFIDEDAE
EEDDSDNDLLRFEDEDDDEDEEDDDLRDMIVSQFKEDPTDKDRRNELHQKWLEQQDAAGTEKLLQKLKRGLQHDETLLSE
DEDENDDTDDEERAEDADDEEVQKPEASEEGDEDEEDPSHANSMRMTIKKIKEMIPLMFTDEDDVYVSSDDEEMEKKLMQ
QRLYKKMELKAKSSSSTGDENSEEILRHIKKPEIKKKAKPSSFKERALMEINKNPAASKSSFLGRLTKSSMPEGSRKRGS
NVVRGYIFERDDSNSKSSNTVPEEPSAPETIIKEKSRPKRAPAKFTASQSQERSATLQATAVEETSTRQRTNLYEILKMS
SKKTCFNSRETMISSNHTESIFAAFKLDKKPVKTNPQLQRNSTCGE*

DNA
ATGATGAACGACGAGCAGCTTTCTCCTATCGGAGAATCGAGTGTCCCAGTTCCAAACAGGATGCTTAGGCGATTGAAGAA
AGCTAAATCGATCTCCGATTTATGTCCTGGATCCGACGGCGAGGATCTGGGTAAGTCTGAATTGCAGTCTGGGAAGGGTT
TCGATGGGTTTGAGGAAGAAGACGGGGTTCGATCTGATCTCAAGGGTTTGGGTGTGGAGGATGAAGTTACCGCAAAAAAG
GTTCTTGATTTTGATTCTGTGCCTGAGTTTAACCAGACTCTTGAAGATCTGGGCGATAAAGCTGAAGAAGACGGAATCTC
TGATTCGGAAACTAGAGATGAAATTAGGGCTGTTGAAACAACGGAAGCTGGAAAGGAGCGGCCAATTAGTGCGCCTGAGT
TTGATGGAATCTGTGATTTGGATACAGAAGAAGAAATCAGGGTTTCGGAAACAACGAAGGAAGCTGGAAAGAAGCGATCG
ATTCCGGAGACAAGTGATGGAGAGGGGAAGGAGAGAAAGAGAGATAAGAAGAGGAACAAGAAGAGTGACGATTTTGATGA
ACTACCAGTCTCTACTGCTTCCATGAACATGACTAAGAAGGAAAGAAGGGAATATCTTGATCAGCTTCGTGCAGAAAATC
AGAGACTCTTGCGAGAAACTAGAGATGCTGCATTTGAACCCGCCCCTCTTGTCCGAAAGCCGATTTCATCTGTCTTGGAG
AAAATTCGAAGAAGAAAAGAGGAGATTTCAAAACAATTCCTTAGCAGGAAGAAATCCAAATCTATTGATATATGCGACGA
GGATGATTTTGAGGAAGTTGTAGCTGAAGAGAAGAATGAAGAAAGTACAAGCAAGCAAAGCCATGGAGGACAGCATTGCT
CGGAGGACTCTGCAGGTCCATTGGAGAACTCAGACAGTCCCTCTTACAAAAAAGCTGAAAGTACCCCTACTCATCAGGAT
CCATCCCTGCGTCCACAAACGATTAACTCTGGAGATGAACTTCTAGAGAAGACGTCAAGCAGATCTTTGGAAGAAGCAAT
GACACCGTCAGTAGTTGCCATGAACCTCAAACTTAACCTGTCTCCTGTGCCTGATAAATCTTCTGAAGAAACAGAGTACA
GAAAGGAAAATTCTGATCCTGAGACCCATGATTCATCTCCTGGCGACCCTGTTAGAAAATTTATTGATGAGGATGCTGAA
GAGGAAGATGACAGCGACAATGATCTACTCCGATTTGAGGATGAGGATGATGATGAAGATGAAGAAGATGATGATCTCAG
GGATATGATTGTCAGTCAATTTAAGGAAGATCCAACTGATAAAGATAGACGTAATGAACTGCATCAGAAGTGGCTCGAAC
AACAAGATGCTGCAGGGACAGAGAAACTCTTACAGAAGCTTAAACGTGGTTTGCAGCATGATGAAACATTATTGTCTGAA
GATGAAGATGAAAATGACGATACTGATGATGAAGAGAGGGCTGAAGATGCTGATGATGAAGAAGTGCAAAAACCTGAAGC
CAGTGAAGAAGGAGATGAAGATGAAGAAGATCCAAGTCATGCAAATTCCATGCGAATGACCATAAAGAAAATTAAGGAAA
TGATCCCTTTAATGTTCACAGATGAAGATGATGTTTATGTATCATCAGACGACGAGGAAATGGAAAAGAAGCTTATGCAA
CAGCGATTGTACAAGAAAATGGAGCTAAAGGCCAAGTCTTCGTCATCCACTGGGGATGAAAACTCTGAGGAAATTCTTCG
CCACATCAAGAAGCCTGAGATCAAGAAGAAGGCAAAACCTTCTTCTTTTAAAGAGAGGGCACTCATGGAAATAAACAAAA
ACCCTGCAGCATCCAAGTCATCGTTCTTGGGTAGACTTACAAAGAGTTCCATGCCAGAAGGATCTCGCAAGCGCGGTTCA
AATGTTGTACGTGGCTATATATTCGAACGTGATGACAGTAACAGCAAAAGCTCAAACACAGTGCCAGAGGAACCTTCAGC
TCCAGAGACGATTATTAAAGAAAAAAGCCGACCAAAAAGAGCTCCGGCAAAATTCACTGCCTCACAGTCACAAGAGAGAT
CAGCAACATTACAGGCGACAGCAGTGGAGGAGACGAGCACGAGGCAACGAACTAACTTGTACGAGATTCTAAAGATGTCA
TCAAAGAAAACTTGCTTCAATTCACGGGAGACAATGATAAGCAGCAACCACACCGAGTCTATATTTGCTGCTTTCAAACT
GGATAAGAAACCAGTTAAGACGAATCCACAATTGCAAAGAAACAGCACGTGTGGTGAATGA