Details for Lyrate rockcress Locus 16059215

Position : sca3 ( 5`- 8170848 .. 8169583 -3` )
Annotation : [B2G] oxidoreductase [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059215

Protein [Map View]
MGELDEAFIQAPEHRPNTHLTNSNDFIYSDEIPTIDLSSLRDPDHDKTAIAAEIAEACKRWGFFQVINHGLPSDLRRRVE
EACAEFFNLTTEEKRKVKRDEVNPMGYHDEEHTKNVRDWKEIFDFFLQDSTIVPATPEPEDTELRKLTNQWPQNPSHFRE
ACQEYAREVEKLAFRLLELVSISLGLPGDRLTGFFNEQTSFLRFNHYPPCPNPELALGVGRHKDGGALTVLAQDSVGGLQ
VSRRSDGQWIPVKPISDALIINIGNCIQVWTNDKYWSAEHRVVVNTSKERFSIPFFFFPSHEANIAPLEELISEENPPCY
KTYNWGKFFVSRNRSDFKKLEVENIQIDHFKA*

DNA
ATGGGAGAACTCGACGAAGCTTTTATCCAAGCTCCAGAACACAGACCAAACACTCACCTCACAAACTCCAATGATTTTAT
TTACTCCGACGAGATCCCGACCATCGACCTTTCTTCTCTCAGAGATCCCGATCACGACAAGACGGCGATCGCGGCGGAGA
TTGCAGAGGCATGCAAGAGATGGGGATTTTTCCAGGTGATCAACCACGGCTTACCTTCGGATTTAAGGCGTCGTGTAGAG
GAGGCATGTGCTGAGTTTTTCAATCTAACAACGGAGGAGAAGAGGAAAGTGAAAAGAGACGAAGTGAATCCTATGGGTTA
TCACGACGAGGAACACACCAAGAACGTTAGAGATTGGAAAGAGATTTTTGATTTCTTCTTGCAAGATTCTACGATAGTTC
CGGCGACACCGGAGCCGGAAGATACTGAGCTCAGAAAGCTCACGAACCAGTGGCCTCAAAACCCTTCTCATTTCAGAGAG
GCATGCCAAGAATATGCAAGAGAAGTTGAGAAGTTAGCTTTTAGGCTATTGGAACTTGTCTCCATTAGTTTGGGTCTACC
TGGTGATCGGTTAACCGGTTTCTTCAATGAGCAAACTAGTTTTTTGAGGTTTAACCATTACCCTCCTTGCCCGAACCCCG
AGCTAGCATTAGGTGTTGGACGTCACAAAGATGGAGGAGCTTTAACCGTCCTGGCCCAAGATAGTGTAGGTGGATTACAA
GTTAGTCGTAGATCGGATGGACAATGGATCCCCGTGAAACCGATCTCGGATGCTTTGATCATTAACATTGGCAATTGTAT
TCAGGTGTGGACAAATGATAAGTATTGGAGTGCTGAACATAGAGTGGTGGTGAACACAAGCAAAGAGAGATTCTCAATAC
CATTCTTCTTCTTCCCGTCACATGAAGCCAACATTGCGCCATTGGAGGAGCTTATAAGTGAAGAAAACCCGCCTTGTTAT
AAAACGTACAACTGGGGAAAGTTCTTTGTTTCAAGAAACAGAAGTGATTTCAAGAAGCTCGAGGTTGAGAATATCCAGAT
TGATCACTTCAAGGCTTAG