Details for Lyrate rockcress Locus 16059189

Position : sca3 ( 5`- 3794587 .. 3795159 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897117 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059189

Protein [Map View]
MSVTLSHPSSCLVLLLLLFSGHPSASGTSIPDMVNTAARVLNRARRAKLAREFLQAHNDARVSSGVPTLEWDRDLARFAD
KWAKQRKPDCSMIHSGGPYGENIFWYRRKNMWSPEKVVTRWYEERFNYDVKTNTCASGKMCGHYTQMVWRATTAVGCARV
KCNNGRGYLVVCEYDPRGNYEGERPFDQNS*

DNA
ATGTCTGTAACGTTGTCTCATCCATCATCATGTCTTGTCCTTCTCCTCCTTCTATTTTCCGGTCATCCCTCCGCCTCCGG
GACCTCCATCCCCGACATGGTGAACACGGCGGCACGTGTGTTAAACAGAGCGAGAAGAGCAAAACTTGCGAGAGAATTTC
TACAAGCGCACAACGATGCACGTGTTTCTTCAGGCGTGCCAACTCTCGAATGGGACAGAGACCTGGCCCGATTCGCTGAT
AAATGGGCTAAACAACGTAAGCCCGATTGCAGCATGATACATTCAGGTGGGCCTTACGGCGAGAACATTTTCTGGTACCG
GCGTAAGAACATGTGGTCGCCGGAGAAAGTGGTGACGAGATGGTATGAGGAAAGGTTTAACTACGACGTGAAAACAAACA
CGTGCGCATCGGGAAAGATGTGCGGCCATTACACGCAGATGGTGTGGAGAGCCACCACAGCCGTTGGATGCGCACGTGTG
AAATGCAACAACGGTCGTGGCTATCTTGTGGTGTGTGAATATGACCCACGTGGGAATTACGAAGGTGAAAGACCTTTTGA
TCAAAACAGTTAA