Details for Lyrate rockcress Locus 16059165

Position : sca3 ( 5`- 2838461 .. 2837290 -3` )
Annotation : [B2G] heat shock protein binding protein
External links : CoGe
PGDD synteny : 16059165

Protein [Map View]
MGKIRPGPDPKAALVSDILSLSRSPISCIHINCISSGSCFIDWYLILGIQEDAEVKVIRKRYHKLALKVHPDKNNHPKAD
IAFKLIHEAYLCLSDETRRISFNTDRRKNICLKCSRVSHKTKENRNDSKPNRFCQTLKDIRDKFREENKVIERCLKTNSA
IFMGNRTKETPVYGIPNQNRLKKESPVFNPSDYRLWGYPHVRNRVFDYNLSSDWNMFTRSRSTCVHSS*

DNA
ATGGGTAAGATCCGACCCGGACCGGATCCAAAAGCGGCATTGGTCTCAGATATTTTATCCCTATCGAGATCACCAATCTC
TTGCATTCACATCAATTGCATCTCATCCGGTTCATGTTTCATCGACTGGTATCTCATTCTCGGTATCCAGGAAGATGCAG
AGGTCAAGGTCATACGTAAAAGATATCACAAATTAGCTTTGAAAGTTCATCCGGATAAAAACAATCACCCAAAGGCAGAT
ATTGCTTTTAAGCTCATCCACGAGGCTTATTTATGTCTTTCAGACGAAACAAGGAGAATAAGCTTCAACACAGATCGACG
AAAGAACATTTGTCTAAAATGCAGCCGAGTCTCACACAAAACCAAAGAGAACCGTAACGATTCTAAACCAAACCGGTTCT
GCCAAACCCTCAAGGACATTAGGGACAAGTTCAGAGAAGAGAACAAGGTGATAGAGAGGTGTCTAAAAACCAATAGTGCA
ATCTTCATGGGGAACCGAACCAAGGAAACCCCGGTTTATGGTATACCAAACCAAAACCGATTAAAGAAGGAGTCGCCTGT
TTTTAATCCATCGGATTACAGGTTATGGGGTTATCCACATGTGAGAAATCGGGTGTTCGACTACAACTTGTCGTCGGATT
GGAATATGTTCACGAGAAGCAGATCCACTTGTGTTCACTCATCGTGA