Details for Lyrate rockcress Locus 16059108

Position : sca3 ( 5`- 2412673 .. 2411076 -3` )
Annotation : [B2G] short-chain dehydrogenase reductase family protein
External links : CoGe
PGDD synteny : 16059108

Protein [Map View]
MAAISPFFLLFLIPIVPLSILAILALIVRPRPIKIPIKSRHVFITGGSSGIGLALAHRAAAEGARVSILARSAGKLEEAK
KEIQLATGVEVATFSADVRDYDAVSKAIDESGPIDVLIVNQGVFTAKELVTHSPEDVKFTIDVNLVGSFNVIKAALPAMK
ARKDRGPASISLVSSQAGQVGVYGYAAYSASKFGLQGLAQALQQEVIADDIHVTLIFPPDTNTPGFEEEQKSRPDVTAII
AASSGSMETEEVARKAMDGIKAGKFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLIALFFQWDWYKAIEKW
SKTKTK*

DNA
ATGGCGGCCATTTCTCCTTTCTTCCTTCTCTTCCTCATTCCCATTGTCCCACTCTCGATTCTCGCTATCCTAGCCCTAAT
CGTACGTCCTCGCCCCATTAAGATCCCTATCAAGTCCCGTCACGTCTTCATCACCGGTGGATCTAGCGGCATCGGTCTTG
CTCTCGCCCACCGCGCCGCTGCCGAGGGTGCTCGTGTCTCAATCCTCGCCCGATCCGCCGGAAAGCTAGAGGAAGCTAAA
AAGGAGATCCAGCTCGCCACTGGTGTCGAAGTCGCCACATTCTCCGCCGACGTTCGCGATTACGATGCAGTGTCGAAGGC
GATTGACGAATCGGGACCGATCGATGTGTTGATTGTTAATCAAGGTGTGTTTACGGCGAAGGAGCTGGTGACACATAGTC
CTGAGGATGTCAAATTCACGATTGACGTGAATCTTGTTGGGAGCTTCAATGTGATTAAAGCCGCTTTGCCCGCCATGAAA
GCAAGGAAAGATCGTGGGCCTGCTTCCATCAGTCTCGTCTCCTCTCAAGCTGGTCAGGTGGGTGTCTATGGTTACGCTGC
ATATTCAGCAAGCAAGTTTGGTCTTCAGGGTTTAGCACAAGCACTGCAACAAGAAGTTATTGCTGATGACATTCATGTCA
CTCTTATTTTTCCTCCTGACACCAATACACCCGGCTTTGAAGAAGAACAGAAGAGTAGACCTGACGTCACTGCCATAATA
GCTGCATCTTCTGGTTCAATGGAAACAGAAGAAGTAGCCAGAAAAGCTATGGATGGCATAAAAGCAGGAAAGTTCACTGT
CTCATGCAACTTTGAGGGATTCTTACTGTCTCTCGCGACAACCGGCATGTCCCCTCAAAGATCATTTTGGCTAGCATTTC
TCGAAGTAATAACCGCAGGGCCTATAAGATTAATCGCTCTCTTCTTTCAATGGGATTGGTATAAAGCCATTGAAAAATGG
AGCAAAACCAAAACCAAATAG