Details for Lyrate rockcress Locus 16059107

Position : sca3 ( 5`- 8292765 .. 8294801 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059107

Protein [Map View]
MGTSQSREDRITESDTDSDSDYYDEEDEDQYDDAKKQGSSSVSGSGPSDSSSSGPSDSSSLDIEEKLKALKLKYPSSSSV
TLKMKNAVKLYRHIGGNTPKAKWIITDKMTSYKFVKTSTADGEDIGDYDDCEESGEGGESFWFLGVGTKVKARVSTDMQL
KMFGDQRRVDFVSNGVWALKFLTDEDYRKFVTRFQDYLFENVYKIRASEENRIKVYGKDFIGWANPEAADDSMWEDAEAP
PEEEETQAKRNTDLTEEFEEVANGGVQSLTLGALDNSFLVNDYGVQVYRNMERGIHGKGVCVRFDSGTSKFGSGSSQTTP
NKALLMRAETNMMLISPAKQGKPNSTGVKQLDIESGKIVTEWKFEKDGTEITMRDITNDTKGSQLDPSESTFLGLDDNRL
CQWDMRDRRGIVQNIESPILEWTQGHQFSRGTNFQCFATTGDGSIVVGSLDGKIRLYSKTSMRMAKTAFPGLGSPITHLD
VSYDGKWILGTTDTYLVLICTLFTDKDGRTKTGFSGRMGNKIPAPRLLKLTPLDSHLAGKDNKFHGGHFSWVSESGKQER
HIVATVGKFSVIWDLERVKNSAHDCYRNQQGLKSCYCYKILLKDESIVESRFMHDNFSFSGNKSPEAPLVVATPLKVSSI
SLSGKRL*

DNA
ATGGGTACTTCTCAAAGTCGCGAAGATCGAATCACCGAATCGGATACGGATTCCGATTCAGATTACTATGACGAAGAAGA
CGAGGATCAATACGATGACGCGAAGAAGCAAGGATCGTCGTCTGTTTCTGGTTCAGGACCGTCTGATTCTTCTTCTTCAG
GACCATCTGATTCATCGTCTCTCGATATTGAGGAGAAGCTAAAAGCCTTGAAGTTGAAATACCCATCTTCTTCTTCCGTA
ACGCTCAAGATGAAGAACGCGGTTAAGCTTTACCGCCATATAGGTGGAAACACACCCAAAGCGAAATGGATTATCACGGA
TAAAATGACATCGTACAAGTTTGTGAAAACTTCGACGGCGGATGGAGAAGATATTGGTGATTATGATGATTGTGAAGAAT
CAGGTGAAGGAGGTGAGTCTTTTTGGTTTCTGGGTGTTGGTACTAAGGTTAAAGCTAGGGTTTCCACGGATATGCAGTTG
AAAATGTTTGGGGATCAGCGTAGAGTTGATTTTGTGAGTAATGGCGTTTGGGCTTTGAAGTTCTTGACGGATGAGGACTA
TAGGAAGTTTGTTACTAGGTTTCAGGACTATCTGTTTGAGAATGTGTATAAGATCAGGGCAAGTGAGGAGAACAGGATTA
AAGTGTATGGGAAAGATTTCATTGGGTGGGCTAATCCTGAAGCTGCTGATGATTCTATGTGGGAGGATGCTGAAGCTCCA
CCTGAGGAAGAGGAAACTCAGGCCAAGAGAAATACGGATTTGACGGAAGAATTCGAAGAGGTGGCTAATGGTGGAGTTCA
GAGTTTGACTTTGGGAGCGTTGGATAATTCATTCTTGGTGAATGATTATGGGGTTCAGGTTTATAGGAATATGGAGCGTG
GGATTCATGGGAAAGGTGTGTGCGTGAGATTTGATTCTGGAACCTCAAAGTTCGGATCGGGTTCGAGCCAGACAACACCA
AACAAGGCTCTTTTGATGAGGGCAGAGACTAATATGATGCTGATAAGTCCAGCTAAACAAGGGAAACCAAATTCCACTGG
TGTTAAGCAGCTCGACATTGAGTCAGGGAAGATTGTTACTGAATGGAAATTCGAGAAAGACGGGACTGAAATCACGATGA
GGGACATAACAAATGATACCAAAGGGTCGCAACTAGATCCATCAGAGTCTACCTTTTTGGGATTGGATGACAATAGGCTG
TGTCAATGGGACATGAGGGACAGGAGAGGTATAGTGCAGAACATCGAATCTCCCATCTTGGAATGGACTCAAGGCCATCA
GTTTTCTAGAGGAACAAATTTCCAGTGCTTTGCAACTACTGGAGATGGGTCAATTGTTGTGGGATCGCTTGACGGAAAGA
TAAGGCTGTATTCAAAGACCTCAATGAGAATGGCAAAAACGGCTTTTCCAGGGCTTGGTTCACCAATTACACATTTGGAC
GTTTCTTATGATGGAAAATGGATATTGGGAACAACAGATACGTACTTGGTTCTTATTTGCACCCTTTTCACAGACAAAGA
TGGTCGGACAAAAACAGGATTTAGCGGAAGAATGGGAAACAAAATACCAGCGCCGAGGCTGCTGAAGCTAACACCACTAG
ATTCACACTTGGCAGGAAAAGATAATAAGTTTCATGGCGGTCACTTCTCATGGGTAAGTGAGAGCGGGAAGCAAGAGAGA
CATATAGTAGCAACAGTGGGGAAATTCAGTGTAATATGGGACTTGGAGCGGGTGAAGAATAGTGCACACGACTGCTATAG
GAACCAACAAGGACTCAAGAGCTGTTACTGCTACAAGATCTTGTTGAAGGATGAGTCAATTGTTGAGAGCCGATTCATGC
ACGATAACTTCTCCTTCTCCGGTAACAAATCGCCAGAAGCACCGCTTGTGGTTGCCACTCCTTTGAAAGTCAGCTCCATC
AGCCTCTCTGGAAAACGACTTTAA