Details for Lyrate rockcress Locus 16059091

Position : sca3 ( 5`- 4710283 .. 4711190 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059091

Protein [Map View]
MAIVSPNFCAPYPIELGIVRKVMTLTDGNFAVTDVNGNLLFKVKEPMFSISDKRILLDAYDTPILTLRENKVSLHDRWQV
FRGKSTDQSDLVYTLKRSSMIQIMKPKLDIFLAQNKEMKICDFHVKGSWIDRSCVVYAGKSDAMVAQMHKKHTAESILIG
KSNFSVTVYPNVDFAFIVSLIVILDDINREDSE*

DNA
ATGGCGATCGTGAGCCCTAACTTCTGTGCACCGTACCCTATAGAGTTGGGAATCGTACGCAAGGTGATGACTTTAACCGA
TGGTAACTTCGCCGTCACGGACGTTAATGGCAATCTCCTTTTCAAAGTGAAAGAACCAATGTTTAGCATCAGCGACAAAA
GGATTTTATTGGACGCATATGATACTCCAATCTTGACTTTGAGAGAAAATAAGGTGAGCTTGCATGATAGGTGGCAAGTA
TTTAGAGGGAAAAGTACAGACCAAAGTGATCTAGTATACACATTGAAACGATCGTCGATGATTCAAATAATGAAGCCAAA
ACTTGACATCTTTTTGGCTCAAAATAAAGAAATGAAGATATGCGACTTCCATGTGAAAGGAAGTTGGATCGACCGGTCTT
GTGTCGTATACGCTGGCAAATCTGATGCCATGGTTGCTCAGATGCACAAGAAACATACCGCAGAAAGCATATTAATAGGG
AAGAGTAATTTTTCGGTTACGGTCTATCCGAATGTTGACTTTGCTTTTATAGTCTCTCTTATTGTAATTCTCGATGACAT
TAACCGAGAAGATTCAGAATAG