Details for Lyrate rockcress Locus 16059015

Position : sca3 ( 5`- 8646593 .. 8642823 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16059015

Protein [Map View]
MHRQGSSPITPSSYNVAVSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPMLMMSGTPLARVRLSDILPYEGAPSPVYA
KAVEALSVSLMRYNASVIEIGSDDTALMRCGLEAARLYFRTRSLNVSGKGNRGLSMYRAGRSVEDLDSSPPCMAEIFRCL
GKVARAALSAIARHLRLRSDVFNHMLDDFPLAPNEVSSSVLLASYAHASIQNGKHASGGGNLSAKIEVEKGLLTLFCSDG
TGIQVCDPNGRWYTADNGCGVGDLLLITGKALSHATAGLRPAASYRTTTDHLSGTDTRGRASLAFRLMPKSNAILDCSPI
EAAGHVIPQSYVPVSVSQFMDNLLAENDTLVNPPVKANVPRDDVCKEPSLRSVLSDPISGAFLEDAMVVSCGHSFGGLML
RRVLEMSRCTLCNAEIESGSLVPNHALRAAASAIKQQDDKRLFHNAAMRRRRKEMSDQMDVENGDPATDDGMHRVVHYPF
AVNEKVLIKGNRRTPEKFVGKEAIVTSQCLNGWYLLKIVESGDNVRLQYRSLKKMVNDDRGGGLQVQPVESNSL*

DNA
ATGCACCGGCAGGGCTCGTCTCCGATTACGCCTTCAAGCTATAACGTCGCCGTTTCTATTGCTTCTGATGTACCTACTGG
CTTAACCAAGTCTCCTTTATCTCACGCGATTCCAGTTTCGCCGATTTCTGCTGCTTACCCTTCCGGTGATCCAATGCTGA
TGATGTCTGGGACTCCTCTTGCTAGGGTTCGATTATCTGATATTTTGCCTTATGAAGGAGCTCCTTCTCCGGTGTATGCA
AAAGCCGTGGAGGCTTTGTCTGTGTCTTTGATGAGGTATAATGCGTCTGTGATCGAAATAGGGAGCGATGACACTGCACT
GATGCGATGTGGACTTGAAGCTGCTCGTTTGTATTTTAGAACTAGAAGCCTTAATGTTTCTGGTAAAGGCAATCGTGGCC
TCTCTATGTATAGAGCTGGAAGATCTGTTGAAGATTTAGATTCTTCACCTCCATGCATGGCTGAGATTTTCCGGTGCTTG
GGTAAAGTAGCACGAGCTGCTTTATCTGCAATAGCAAGGCATCTACGTTTAAGAAGCGATGTTTTTAACCATATGCTCGA
TGACTTTCCACTAGCTCCGAACGAGGTTTCCTCCTCGGTGCTACTGGCTTCCTATGCTCATGCATCAATACAAAATGGAA
AACATGCTTCTGGAGGTGGGAATCTATCTGCTAAAATTGAAGTTGAAAAGGGTTTGTTGACACTGTTCTGCTCAGATGGC
ACTGGCATTCAGGTATGTGACCCAAATGGTCGTTGGTACACAGCAGATAATGGGTGTGGGGTGGGTGATCTCTTATTGAT
TACCGGCAAAGCGCTTAGTCATGCTACTGCAGGTCTCCGTCCAGCTGCCTCTTACAGAACTACTACCGATCATTTGTCTG
GCACTGACACTCGCGGAAGGGCATCATTAGCTTTTAGGCTTATGCCGAAAAGTAATGCTATATTAGATTGTTCCCCAATA
GAAGCAGCCGGCCATGTAATTCCTCAAAGCTATGTGCCAGTATCTGTTAGTCAGTTTATGGATAACCTCTTGGCCGAGAA
TGACACTCTAGTTAATCCGCCTGTGAAAGCAAATGTTCCGCGGGATGATGTTTGCAAAGAGCCTTCCTTAAGAAGTGTTC
TCTCGGATCCAATTTCTGGGGCTTTTCTTGAAGATGCAATGGTTGTCTCTTGTGGACACTCATTTGGTGGCCTCATGCTT
AGAAGAGTTCTTGAAATGTCTAGATGTACGCTCTGCAATGCAGAAATCGAGTCTGGGTCTCTGGTTCCTAACCATGCACT
TAGAGCTGCCGCTTCAGCTATAAAGCAACAGGATGATAAAAGACTTTTCCACAACGCAGCCATGAGGAGGCGTAGAAAAG
AAATGAGTGATCAAATGGATGTGGAAAATGGAGATCCAGCTACGGATGATGGGATGCATCGAGTGGTGCATTATCCATTT
GCTGTAAATGAGAAAGTGCTTATCAAGGGAAACCGGAGAACCCCGGAAAAGTTTGTTGGAAAAGAAGCAATTGTGACATC
TCAATGTCTCAATGGCTGGTATCTATTAAAGATTGTCGAAAGCGGAGACAATGTGCGGCTGCAATACCGATCCCTAAAAA
AGATGGTGAACGATGACAGAGGAGGAGGCCTACAGGTTCAACCGGTTGAGAGCAATAGCTTGTAG