Details for Lyrate rockcress Locus 16059011

Position : sca3 ( 5`- 5521244 .. 5522541 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478749 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16059011

Protein [Map View]
MTEAESKTVVPESVLKKRKREEEWALAKKQELEAAKKQNAEKRKLIFNRAKQYSKEYQEKERELIQLKREAKLKGGFYVD
PEAKLLFIIRIRGINAIDPKTKKILQLLRLRQIFNGVFLKVNKATINMLRRVEPYVTYGYPNLKSVTELIYKRGFGKLNH
QRIALTDNSIVDQGLGKHGIICVEDLIHEIMTVGPHFKEANNFLWPFQLKAPLGGMKKKRNHYVEGGDAGNRENFINELV
RRMN*

DNA
ATGACTGAAGCAGAGTCCAAGACTGTTGTCCCTGAGTCAGTGTTGAAGAAGAGAAAGAGGGAGGAAGAATGGGCACTTGC
CAAGAAACAGGAGCTTGAGGCTGCCAAAAAGCAGAATGCTGAGAAGAGGAAACTCATATTTAACCGGGCAAAGCAATACT
CCAAGGAGTACCAGGAGAAAGAAAGGGAATTAATCCAGCTGAAGCGTGAGGCAAAATTGAAAGGAGGCTTTTATGTTGAC
CCAGAAGCTAAACTGCTTTTCATTATCCGTATCCGTGGTATCAATGCCATTGACCCAAAGACAAAGAAGATTTTGCAGCT
TTTGCGTCTAAGACAGATTTTCAATGGTGTGTTCTTGAAGGTCAACAAGGCAACCATTAACATGCTTCGCCGTGTTGAAC
CCTATGTGACCTATGGATACCCGAACTTAAAAAGTGTGACGGAATTGATTTACAAACGAGGTTTTGGAAAGCTCAACCAC
CAGAGGATTGCCTTGACAGACAATTCCATTGTAGACCAGGGACTAGGGAAGCATGGTATCATCTGCGTTGAAGATCTGAT
CCATGAGATCATGACGGTTGGGCCACATTTCAAGGAAGCCAACAACTTTTTGTGGCCATTCCAGTTGAAGGCGCCATTGG
GAGGGATGAAGAAGAAGAGGAACCATTACGTGGAAGGAGGAGATGCTGGAAACCGCGAGAACTTCATCAACGAGCTCGTT
AGGAGAATGAACTGA