Details for Lyrate rockcress Locus 16058999

Position : sca3 ( 5`- 5575710 .. 5574838 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058999

Protein [Map View]
MASSRVLGRFSSRLKPLCQNLSNKNANVSSLPSPIKSASPSSATTCRLNRSSRLPVELSSMIPLHSAIASSRLVSSLSIE
SKIWGLVPQGLSLPL*

DNA
ATGGCATCTTCAAGAGTGTTAGGCAGATTCTCGTCTCGATTAAAGCCACTATGTCAAAATCTCAGCAACAAGAATGCCAA
TGTTTCATCACTCCCCTCTCCCATCAAATCTGCTTCACCTTCCTCAGCAACTACTTGTCGTCTCAATCGATCTTCAAGAT
TACCAGTGGAGTTGAGCTCGATGATACCTCTACACAGTGCTATAGCATCGTCCAGGCTAGTCTCAAGTTTGTCCATTGAA
TCCAAAATCTGGGGATTAGTTCCTCAAGGTCTTTCATTGCCTTTATGA