Details for Lyrate rockcress Locus 16058993

Position : sca3 ( 5`- 5909233 .. 5907466 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_897690 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058993

Protein [Map View]
MCGGAIISDFIPPPRSLRVTSEFIWPDLKNKGKKASKKRSNKRPDFFDLDDEFEADFRGFKDDSAFDCEDDFDDDVFVNV
KPFVFTATTKPVASSVPVFASTVGSASAKKTVESDGQADTSSKRKRKNQYRGIRQRPWGKWAAEIRDPRKGSREWLGTFD
TAEEAARAYDAAARRIRGTKAKVNFPEEKNASVSQKRPTGKTNNLQKQVAKPNKSVTLVQQPTHLSQQYCNNSFDNMGND
SFGDMSFMEEKPQMYNNQFGLTNSFDAEGNNGFQYFSSDQGSNSFDCSEFGWRDHGPKTPEISSMLVNNIQAPFVEETNA
AKKLKPNSDDSDDLMAYLDNALWDTPLEVEAMLGADAGAVTQEEENPMDVWSLDEINFMLEGDF*

DNA
ATGTGTGGAGGAGCTATAATCTCCGATTTCATTCCGCCGCCGAGGTCCCTCCGTGTCACTAGCGAGTTTATCTGGCCGGA
TCTGAAAAACAAAGGGAAAAAAGCTTCGAAGAAGCGATCGAATAAGCGACCCGATTTCTTCGATCTGGACGATGAATTCG
AAGCTGATTTCCGAGGGTTTAAGGATGACTCGGCTTTTGACTGCGAAGACGATTTCGATGATGATGTCTTCGTCAATGTG
AAGCCTTTTGTCTTCACGGCGACTACTAAACCCGTAGCTTCCTCTGTCCCCGTTTTCGCATCCACTGTAGGATCAGCATC
AGCCAAGAAAACTGTAGAGTCCGATGGGCAAGCTGACACATCTTCTAAGAGGAAGAGGAAGAATCAATACCGAGGAATTA
GGCAGCGCCCTTGGGGCAAATGGGCTGCTGAGATCCGTGATCCCAGAAAAGGCTCCCGAGAATGGCTTGGAACATTCGAC
ACTGCTGAGGAAGCAGCAAGAGCTTATGACGCAGCAGCACGCAGAATCCGAGGCACAAAAGCTAAGGTGAATTTCCCAGA
GGAGAAGAACGCTTCCGTCTCCCAGAAACGTCCTACTGGTAAGACCAATAATCTTCAGAAACAAGTGGCTAAACCAAACA
AAAGCGTAACTTTGGTTCAGCAGCCAACACATCTGAGTCAGCAGTACTGCAACAACTCCTTTGATAACATGGGGAATGAC
TCCTTTGGTGATATGAGTTTCATGGAAGAGAAGCCTCAGATGTACAACAATCAGTTTGGGTTAACAAACTCGTTCGATGC
TGAAGGTAATAATGGATTCCAGTATTTCAGTTCCGATCAGGGAAGTAACTCATTCGACTGCTCTGAGTTCGGGTGGAGAG
ATCACGGCCCCAAAACACCTGAGATCTCTTCAATGCTTGTCAATAACATCCAAGCACCATTCGTTGAAGAAACCAATGCA
GCAAAGAAGCTCAAACCCAACTCTGATGATTCAGACGATCTGATGGCATACCTTGACAACGCCTTATGGGACACTCCACT
AGAAGTGGAAGCCATGCTTGGCGCAGATGCTGGTGCTGTGACCCAGGAAGAGGAAAACCCAATGGACGTATGGAGCTTAG
ATGAGATCAATTTCATGCTGGAAGGAGACTTTTGA