Details for Lyrate rockcress Locus 16058981

Position : sca3 ( 5`- 4983789 .. 4982992 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_478600 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058981

Protein [Map View]
MASPTIRTVASYNTHLEYSVDFFGDELIVTVTPDSSVISRWIRDVLFNNRFSSHPLVVGVGVQWTPFYYYADPLENDYYA
DAPAGRNYSDNPADILQLCVGNRCLIIQLGYCEQVPNNLRSFLGDPETTFVGVWNGQDAGKLARCCHQLEIGELLDIRQY
VNDSWGRSMRRCSFAEIVEECMGYQGVTLDPEISMSDWTVYDLDLDQILQASLDAYVCHQLGVWARLWEV*

DNA
ATGGCTTCTCCGACGATAAGAACCGTCGCAAGTTACAACACTCACCTAGAGTACTCCGTCGATTTCTTTGGAGACGAGCT
CATCGTCACCGTAACTCCGGATTCCTCCGTCATCAGCCGATGGATTCGCGACGTCCTCTTTAACAACCGTTTCTCATCTC
ACCCTCTCGTCGTTGGAGTCGGCGTCCAGTGGACTCCTTTCTATTATTACGCCGATCCTCTGGAGAATGACTACTACGCC
GATGCTCCGGCTGGTAGAAACTACTCAGATAATCCAGCGGATATTCTCCAGTTATGCGTGGGTAATCGGTGTCTCATCAT
CCAGTTAGGTTACTGTGAGCAAGTCCCTAACAATCTCCGCAGTTTCTTAGGAGATCCAGAAACCACGTTCGTAGGCGTTT
GGAATGGTCAAGATGCAGGAAAGCTGGCTCGATGTTGCCACCAGCTGGAGATTGGGGAACTTCTTGACATAAGGCAGTAC
GTGAATGATTCGTGGGGAAGGAGCATGAGGCGTTGCTCGTTTGCAGAGATTGTTGAGGAATGTATGGGTTATCAAGGAGT
CACGCTAGATCCGGAGATAAGCATGAGTGATTGGACCGTTTATGACCTAGACCTTGATCAAATTCTTCAGGCGTCACTAG
ATGCTTACGTTTGCCACCAGCTTGGTGTTTGGGCTCGTCTTTGGGAAGTTTGA