Details for Lyrate rockcress Locus 16058977

Position : sca3 ( 5`- 4816594 .. 4814783 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_341316 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058977

Protein [Map View]
MDPPVSDLESIEDQKEGGPSFHCDLYDTQVVHKIAQVFLPGLATACVDNTTGDIFRSPGSVAADIRKEMIEYLTRRSESF
VAEHIVLQGGSEIEASHDPFDIISDFIDDFATSKRNLFSRVSGWMLSERREDNIDDFAQEMEISGFWLTDHREGIAQTLL
KNVDFKSSAHCEMKFQTEGELAEHTMSCGYRTMNCENEGCTAVFCANQMENHDSVCPFKNIPCEQNCSESIMRRDMDRHC
ITVCPMKLVNCPFHAVGCLSDVHQCEVQQHHLDNVSSHLMYILRSIYKEASPDDLKPRAEQIQQLSTRLSEARNARSLTN
LVKEIDGKLGPLEIKPKIVTNSESDKPENTEKEALEEAEIKENPETSNLKAGTLEQTAEDKVVSKEVNDAMVEEAAKKVS
EAEIAENVNEEGELKAQKLLEIGEFIKEADKNSADDLSERTETKAPEVVVMDEDREEEEESAETKDSRTNETTRGLEMID
EETKKSTEIKTEAPSRIVMDKEEDEETKKSTDTETEAPSRIVMETEDDEETMNSRARASDEAEALSKSSQGFSTVQAETV
PHMS*

DNA
ATGGATCCTCCTGTCTCGGATCTTGAGAGTATCGAAGATCAGAAAGAAGGAGGACCTTCCTTTCACTGTGATCTTTACGA
TACACAAGTAGTTCACAAGATTGCTCAGGTTTTTCTCCCTGGATTAGCCACTGCTTGTGTCGATAACACTACCGGCGATA
TCTTCAGGAGTCCTGGTTCTGTGGCTGCTGACATTCGAAAAGAAATGATTGAGTACTTGACTCGTAGAAGCGAAAGCTTT
GTGGCTGAACACATTGTTCTTCAAGGTGGTTCTGAGATTGAAGCTTCTCATGATCCTTTTGACATTATATCTGATTTCAT
CGATGATTTCGCAACTTCTAAGCGGAATTTGTTCAGCCGGGTTTCGGGTTGGATGCTTAGCGAAAGAAGGGAAGATAATA
TAGATGATTTCGCGCAAGAGATGGAGATAAGCGGCTTCTGGTTGACTGATCATAGAGAAGGGATCGCTCAGACTTTGCTT
AAAAACGTCGATTTTAAAAGCAGTGCTCATTGTGAGATGAAATTCCAAACCGAGGGAGAACTCGCGGAGCATACCATGAG
TTGTGGGTATAGAACCATGAACTGTGAAAACGAGGGTTGCACTGCGGTCTTTTGCGCGAATCAGATGGAGAATCACGATT
CAGTTTGCCCGTTCAAGAATATTCCGTGTGAGCAGAACTGCTCAGAGAGTATCATGAGACGAGATATGGATAGGCATTGT
ATAACCGTATGTCCTATGAAACTTGTCAACTGTCCATTTCATGCTGTTGGTTGTCTATCTGATGTACATCAATGTGAGGT
CCAACAACATCATTTGGATAATGTAAGCTCTCATTTGATGTACATTCTTCGGAGCATCTACAAGGAAGCATCTCCAGATG
ATCTCAAACCCCGAGCTGAACAGATACAGCAGTTGTCTACTCGGTTATCTGAAGCTCGTAATGCAAGATCACTAACGAAT
CTGGTCAAGGAAATTGATGGAAAGCTGGGGCCTTTAGAAATCAAACCAAAGATTGTTACTAACTCGGAGTCCGATAAACC
TGAAAATACAGAAAAGGAAGCATTAGAAGAAGCTGAGATCAAAGAAAATCCGGAAACAAGCAACTTAAAAGCTGGTACAT
TGGAGCAAACCGCGGAAGATAAAGTGGTTTCAAAAGAAGTAAATGATGCAATGGTGGAAGAAGCTGCAAAGAAAGTTTCG
GAAGCTGAGATAGCAGAGAATGTTAATGAAGAAGGCGAATTAAAAGCGCAGAAGCTTTTAGAAATAGGCGAGTTCATAAA
AGAAGCAGACAAAAACTCTGCAGATGATTTATCAGAGAGAACCGAAACCAAAGCTCCAGAAGTTGTGGTCATGGATGAAG
ATAGAGAGGAAGAGGAGGAGAGTGCAGAGACAAAAGACTCAAGAACAAATGAAACAACTAGAGGTTTAGAGATGATTGAT
GAAGAGACAAAGAAATCGACTGAAATTAAAACCGAAGCTCCATCACGAATAGTCATGGACAAAGAGGAGGATGAAGAGAC
GAAGAAATCAACTGATACAGAAACCGAAGCTCCATCGAGAATAGTCATGGAGACTGAGGATGATGAAGAGACAATGAACT
CAAGGGCTCGTGCTTCTGATGAAGCTGAAGCACTCTCAAAGAGCTCTCAAGGTTTTTCTACGGTGCAAGCGGAAACCGTA
CCCCATATGTCTTAA