Details for Lyrate rockcress Locus 16058902

Position : sca3 ( 5`- 4659694 .. 4660047 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058902

Protein [Map View]
MSRRNKNGSKLELRLNLSPPPSQASQMSLVRSPNRSNTTSPTSCVSSETNQEENEAITSMVLVGCPRCLMYVMLSDDDPK
CPKCKSTVLLDFLQENAFAATTATAANTRRNKKTWWN*

DNA
ATGAGCCGGAGGAACAAGAACGGCTCTAAGCTCGAGCTGAGGCTAAACCTTTCGCCGCCTCCTTCTCAAGCCAGCCAGAT
GAGTCTTGTTCGATCTCCAAACCGATCCAACACGACTTCACCGACCTCATGCGTTTCTTCTGAAACGAACCAGGAGGAGA
ACGAGGCAATAACCTCAATGGTTCTTGTAGGTTGCCCTCGTTGCCTTATGTACGTTATGCTTTCTGATGATGACCCTAAA
TGTCCTAAATGCAAAAGCACCGTTCTTCTTGATTTCCTTCAAGAAAACGCTTTTGCCGCTACAACCGCTACCGCTGCCAA
CACCAGACGCAACAAGAAGACCTGGTGGAACTGA