Details for Lyrate rockcress Locus 16058815

Position : sca3 ( 5`- 2354478 .. 2355191 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058815

Protein [Map View]
MVETSLTNEDTIEENAIETCTHIKVGVSMSKAVSSFNFLTVITLSYTNLENGGAIALVNALKNSVPSLQVIEMAGNNITY
EAAPAIAVFLAAKRHLKKLNLSENNLKDEGCLEIVKSMDGLELEYVDMSFNDLRREGALGLARVVIKKESFKMLNIDGNM
ISVKGIEEIKEIFKNCSKLLGPLDKNDPLGEDDDDLRENLEDFEDEFVSVFIFY*

DNA
ATGGTAGAGACTAGCTTGACCAATGAGGATACTATAGAGGAGAATGCAATTGAGACTTGTACTCATATAAAAGTTGGAGT
TTCTATGAGCAAAGCAGTTTCAAGCTTTAATTTCTTGACTGTAATTACCCTAAGTTATACCAATCTAGAGAATGGAGGTG
CTATAGCTTTAGTAAACGCTCTCAAGAACTCTGTTCCATCTCTTCAAGTTATAGAAATGGCTGGAAATAACATAACTTAT
GAGGCGGCTCCAGCTATCGCAGTTTTTTTGGCAGCAAAGCGACATCTGAAAAAGTTGAACTTGTCAGAGAATAATCTAAA
AGATGAGGGATGTCTTGAGATTGTAAAGAGTATGGATGGTTTGGAGTTAGAATATGTTGATATGAGCTTCAATGACTTGA
GAAGAGAAGGAGCATTGGGCTTGGCTCGTGTTGTTATCAAGAAAGAAAGTTTTAAGATGTTGAACATTGATGGGAATATG
ATCTCTGTTAAAGGCATTGAGGAAATCAAAGAGATATTCAAGAATTGTTCTAAGTTACTTGGACCTTTGGATAAGAATGA
CCCTCTTGGAGAGGATGATGATGATTTAAGAGAGAATCTTGAAGATTTTGAAGATGAATTTGTGAGTGTATTTATCTTTT
ATTAG