Details for Lyrate rockcress Locus 16058771

Position : sca3 ( 5`- 8346851 .. 8347285 -3` )
Annotation : [B2G] predicted protein [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058771

Protein [Map View]
MVRLSVSNKVVYYGNLPPYDLASLPPETQRKMIGETLYQMVEELEPRFAPKITGMILELDQDRVFHLMESPEALKETVKE
AMKILADWIPQQMQLLGKEDACKFLASMLPAKL*

DNA
ATGGTTCGTTTATCCGTTTCTAATAAAGTTGTGTACTATGGCAATTTACCTCCATATGATCTTGCTTCTTTACCTCCCGA
AACACAACGAAAGATGATTGGTGAGACTTTGTACCAAATGGTGGAAGAACTTGAGCCACGGTTTGCACCAAAAATCACAG
GAATGATTCTTGAACTGGACCAAGACAGGGTCTTTCATCTGATGGAATCACCTGAAGCCCTCAAAGAAACTGTCAAAGAG
GCAATGAAGATCTTAGCGGACTGGATTCCGCAACAGATGCAACTACTAGGGAAAGAAGATGCTTGCAAGTTCCTAGCTTC
CATGCTTCCTGCTAAACTATGA