Details for Lyrate rockcress Locus 16058694

Position : sca3 ( 5`- 3568233 .. 3569595 -3` )
Annotation : [B2G] potassium channel tetramerization domain-containing protein
External links : CoGe
PGDD synteny : 16058694

Protein [Map View]
MVVFDGGERVKLNVGGEIFETNASTIQSSCPDSLLAALSTPTSHGSNPVFIDRDPEIFAVILNLLRTGRLPANSSGVFSK
QELLDEAMYYGVESLLRLAMLPPPLLGFDASLVSTIVPAADGVPSALTATAGDASLWIAHGGQISVYDWSLSHAGTVRTH
LNDITSICRVWSEAAAIGSGSASGLHFYDLSGGRYVGSTHWTDPEDPRIHKARVAAIADSVGGVFASFDCLHRENSILQI
DKSTLQVAAVIGQQSGNSAKTTVPEKLRWLPTNGLLVGSAVQRGVFGCSGYIRIWDPRSRNIVWETSEPGSGRSTRFGDA
LADMDVDVEELILFKVCSKSGDLGMADIRKLGEDPWVYMSDENPGAWKAGDGGGYSVVHCYRKQVLAARGGALEVWSSVK
EKTSVDPIRRRNFVDKEDDSKRGMISKIEAGGDRLFVSREFMEGVEVWETSNFS

DNA
ATGGTGGTTTTCGATGGCGGCGAGCGAGTGAAGCTCAACGTTGGCGGCGAAATCTTCGAAACCAACGCGTCAACAATTCA
GTCATCTTGCCCAGACTCTCTTCTTGCGGCTCTATCGACTCCAACCTCCCATGGCTCGAATCCGGTTTTCATCGATCGTG
ACCCAGAAATTTTCGCCGTCATTCTCAATCTCCTCCGTACTGGTCGACTTCCAGCTAATTCCTCCGGCGTTTTCTCCAAG
CAAGAGCTACTCGATGAGGCTATGTATTACGGCGTCGAATCACTCCTCAGATTGGCGATGTTACCTCCGCCGCTGCTAGG
TTTCGATGCGTCTCTAGTCTCCACAATCGTACCGGCTGCTGATGGAGTTCCGTCTGCTTTAACCGCCACTGCTGGAGACG
CTTCTCTGTGGATCGCTCACGGCGGTCAGATCTCCGTTTACGATTGGAGTCTTTCTCATGCTGGAACCGTCCGTACGCAT
CTCAATGATATCACATCGATCTGCCGTGTGTGGAGTGAAGCGGCTGCAATCGGATCTGGATCCGCGTCGGGGCTTCACTT
CTACGATCTCTCTGGAGGTCGATACGTCGGATCTACGCATTGGACTGATCCGGAGGATCCGAGGATCCATAAGGCACGCG
TGGCTGCGATTGCCGATTCGGTCGGTGGAGTTTTCGCATCCTTTGATTGCCTGCACAGAGAGAACAGTATTCTCCAGATC
GACAAATCCACGCTCCAAGTAGCCGCCGTGATTGGCCAGCAATCTGGAAACTCGGCTAAAACCACAGTACCGGAGAAACT
CCGGTGGCTGCCAACGAACGGTCTTTTGGTCGGATCAGCCGTTCAACGCGGAGTGTTTGGTTGCTCTGGCTACATCCGGA
TTTGGGACCCAAGGTCCAGGAACATCGTATGGGAAACGAGTGAGCCAGGATCGGGACGAAGCACTAGGTTTGGAGACGCC
TTAGCTGATATGGACGTGGACGTTGAAGAATTGATCCTCTTCAAGGTATGTTCCAAGTCAGGAGACCTCGGAATGGCAGA
CATTCGTAAATTGGGCGAAGATCCATGGGTATATATGTCAGACGAGAATCCCGGGGCGTGGAAGGCCGGTGACGGAGGCG
GTTACAGCGTGGTACATTGTTATAGAAAGCAAGTGTTGGCCGCGAGAGGTGGTGCATTAGAGGTATGGTCAAGTGTTAAG
GAGAAGACAAGTGTTGATCCAATTCGCAGAAGAAACTTTGTAGACAAGGAAGATGATTCCAAGAGAGGGATGATTTCGAA
AATTGAAGCAGGAGGTGATCGGCTCTTTGTTTCTCGGGAATTTATGGAAGGTGTTGAGGTCTGGGAAACTTCTAATTTCT
CAG