Details for Lyrate rockcress Locus 16058683

Position : sca3 ( 5`- 1460473 .. 1461084 -3` )
Annotation : [B2G] endopeptidase inhibitor
External links : CoGe
PGDD synteny : 16058683

Protein [Map View]
MKTFRLMMISFLLVAITTTSGVVGEGNDVVYDGEGDPVKPNVPYYISFMTSDYNMWICRRQYGSTDPNSCPQQPLMVTHP
DMAAPTPVMFVLASKSDVVRESAKLKIKFVGPRQCGKSGFWRVVQRNSLEGEVVLNGSKSKSNNDSTFAIHKTNEYYKFT
FGDGDYPTTISMTNDYPIYRLLSKRLSGEMEIYFYKNLTTGEG*

DNA
ATGAAAACATTCCGATTGATGATGATCTCTTTCTTGCTAGTTGCAATAACAACAACATCCGGTGTCGTTGGTGAGGGTAA
CGACGTGGTTTATGATGGCGAAGGAGATCCGGTTAAGCCCAACGTTCCGTATTACATCAGCTTCATGACGTCGGATTACA
ACATGTGGATCTGCCGAAGGCAATATGGATCTACTGATCCCAACTCATGCCCACAACAACCGTTAATGGTCACTCATCCA
GATATGGCAGCACCCACACCAGTTATGTTTGTATTAGCATCCAAATCAGATGTCGTACGTGAATCAGCCAAACTTAAGAT
TAAGTTCGTAGGTCCCCGTCAGTGCGGTAAATCCGGGTTTTGGAGAGTAGTTCAGAGAAACTCTTTAGAAGGTGAAGTAG
TCCTCAACGGATCTAAATCTAAGTCAAACAATGATAGTACGTTCGCCATCCATAAAACTAACGAATACTACAAGTTCACT
TTCGGTGACGGTGACTATCCAACGACTATCAGTATGACCAACGACTATCCGATATATAGGTTGTTATCAAAGCGGTTATC
TGGAGAGATGGAGATTTATTTCTACAAGAACCTGACTACGGGTGAAGGCTAA