Details for Lyrate rockcress Locus 16058681

Position : sca3 ( 5`- 6227181 .. 6229016 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058681

Protein [Map View]
MTSSLPPPIIFFTVFFFVVHSLSAVSDLHETRSRFKPPQFSPLFFSSPLQNVTKSPTRYFEVQKPPVPNLPTAQPPCSYR
ILHHDFGYTYAKPPVLSNYTLPSHCSSREFSKIVLEFKSTSQGRQFDRIFGVWLDGVMILRSCTAEPRPNGIVWSVEKDV
TKYHSLLVKNETQLLSVYLGNIIDKTYTGVYHVDVIFHFYQLESNLEDPSGYSSPRADMILPISRNLPLNDGLWFEIVNS
NDSKYKEFEIPRNVYRAVLEVYVSFHENDEFWYGNLPNDFVTANNLSVAGNGPFREVVVSLDGDIAGAVWPFPVVFTGGI
NPLLWRPITAIGSFDLPSYDIEITPFLGSLLDGKSHKVGFSVTNALNVWYIDANLHLWLDQEKEIVEGKVLEFSRSSLEI
SSVSDFKGLNGNFTTKAKRSITSIGLVKSSHGDIITNANQEFSYENNMVLGKDGNLQIIDQLIQADDRIHAKRASREIYC
AKSIKSFPFYLDSDSLEQQNNTSLEIANVKMAFNEERSESDNGLMRTFKSKLENKQEGQGVMVVKNNLVVNGYGSTQQVY
NYVGSDQCYFRNISSSNYTILYDELETVCKKKTLKLPPRLEHLPRQQPLLA*

DNA
ATGACTTCCTCTCTTCCTCCACCAATCATCTTCTTCACCGTCTTCTTCTTCGTCGTCCACTCTCTATCCGCCGTCTCCGA
TCTCCACGAAACCAGATCACGTTTCAAACCTCCTCAGTTCTCTCCTCTCTTCTTCTCTTCTCCTCTCCAAAACGTCACAA
AATCCCCTACTCGCTACTTCGAGGTTCAAAAACCTCCCGTCCCAAATCTGCCGACAGCTCAACCACCGTGTTCGTATCGA
ATTCTCCACCATGACTTTGGCTACACCTATGCTAAACCACCGGTTCTCTCCAATTACACTCTTCCCTCTCACTGCTCCTC
TCGAGAATTCTCCAAAATCGTCCTCGAATTCAAATCCACTAGCCAAGGACGACAATTCGATCGGATATTCGGTGTTTGGC
TTGACGGTGTTATGATTCTCCGGAGCTGCACCGCCGAGCCTAGACCAAACGGAATTGTTTGGTCTGTCGAGAAAGATGTG
ACTAAGTATCACTCTTTACTCGTCAAGAACGAGACTCAGCTTCTCTCTGTTTATCTTGGTAATATTATTGATAAAACCTA
TACTGGTGTTTACCATGTTGATGTGATCTTCCATTTCTATCAACTCGAAAGTAATCTTGAAGATCCTTCTGGTTATAGCT
CTCCTCGAGCTGATATGATCCTGCCGATTTCGAGAAATCTTCCGTTGAACGATGGATTGTGGTTTGAAATTGTGAATTCG
AATGATTCTAAGTATAAGGAATTTGAAATTCCTAGGAATGTGTATAGAGCTGTTCTTGAGGTTTATGTTTCTTTCCATGA
GAATGATGAGTTTTGGTATGGAAATCTTCCTAATGATTTCGTTACTGCTAATAATCTCAGTGTTGCTGGTAACGGACCTT
TTAGAGAAGTTGTGGTTAGTCTTGACGGTGATATTGCTGGTGCGGTTTGGCCTTTCCCTGTTGTCTTCACCGGTGGGATC
AATCCTTTGCTCTGGAGACCAATCACTGCTATTGGCTCTTTTGATTTGCCGAGTTATGATATCGAGATCACACCGTTCTT
GGGAAGTTTGTTGGATGGGAAGAGTCATAAGGTGGGGTTTAGTGTGACAAATGCGTTGAATGTTTGGTATATCGATGCGA
ATTTGCATCTTTGGTTGGATCAAGAGAAGGAGATAGTTGAAGGGAAGGTGTTGGAGTTCAGTAGAAGCTCTCTGGAGATT
AGCTCTGTCTCGGATTTTAAAGGCTTGAATGGAAACTTCACGACGAAAGCAAAGAGGTCGATAACTTCGATAGGGTTGGT
CAAATCCTCTCATGGGGACATCATAACTAATGCCAATCAAGAATTTAGCTACGAAAACAATATGGTTTTAGGTAAAGATG
GGAACTTGCAGATCATAGATCAGTTGATCCAAGCCGATGATCGTATTCACGCCAAGAGAGCCTCGAGAGAGATCTACTGC
GCGAAATCCATCAAAAGCTTTCCCTTTTACCTCGACTCTGACTCATTGGAGCAACAGAATAACACTTCTCTGGAGATTGC
GAATGTCAAGATGGCATTCAACGAGGAGAGATCTGAGAGCGACAACGGGTTGATGAGAACATTCAAGAGCAAGCTTGAAA
ACAAGCAAGAAGGGCAAGGAGTAATGGTAGTGAAGAATAACTTAGTGGTCAATGGATATGGAAGCACACAACAAGTGTAT
AACTATGTTGGAAGTGACCAATGTTACTTCAGAAACATCAGTAGCTCCAACTACACTATTCTATATGACGAGCTTGAAAC
TGTTTGCAAGAAGAAAACACTGAAGCTGCCGCCAAGGCTCGAGCATCTACCAAGACAACAACCCTTACTGGCTTGA