Details for Lyrate rockcress Locus 16058667

Position : sca3 ( 5`- 3290512 .. 3291759 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058667

Protein [Map View]
MASEKSFKKRKITDDVDGGGGGGLESLPGDIIADIFSRLPISSIARLMFVCRSWRSILTQHGRVSSSSSPTKPCLLLHCD
SPIRNGLHFLDLSEEEKRIKTKKFTLRFESSMPEFDVVGSCNGLLCLSDSLYNDSLYLYNPFTTNSLELPECSNKYHDQE
LVFGFGFHEMTKDYKVLKIVYFRGSSSSNNGIYRGRGRIQYKQSEVQILTLSSKTTDQSLSWRSLGKAPYKFMKRSSEAL
VNGRLHFVTRPRRHVPDRKFVSFDLEDEEFKEIPKPDCGGLNRTNHRLVNLKGCLCAVVYGNYGKLDIWVMETYGVKESW
GKEYSIGTYLPKGLKQNLDRPMWIWKNAENGKVVRVLCLLENGEILLEYKSRVLVAYDPKLGKFKDLLFHGLPNWFHTVV
HVGTLSWVDTPLDLW*

DNA
ATGGCTTCAGAGAAGAGTTTCAAGAAGAGAAAGATCACCGATGATGTAGACGGAGGAGGAGGAGGAGGACTAGAATCCCT
TCCCGGAGATATCATCGCCGACATATTCTCTCGGTTACCAATCTCCTCCATAGCTCGGCTTATGTTCGTTTGCAGATCTT
GGAGATCAATTTTGACTCAACACGGTCGTGTCTCTTCTTCTTCTTCCCCGACAAAGCCATGTCTTCTCCTTCACTGCGAT
TCCCCAATACGCAACGGTCTTCACTTCCTCGACTTATCAGAAGAAGAGAAACGCATCAAGACCAAGAAATTCACATTAAG
ATTCGAATCTTCCATGCCGGAGTTCGACGTGGTAGGCTCTTGTAACGGTTTGCTCTGTTTGTCTGATTCTCTCTACAACG
ATTCACTCTACCTCTACAATCCTTTTACTACAAACTCCTTAGAGCTCCCCGAATGTTCCAACAAGTACCACGACCAAGAA
CTTGTGTTCGGTTTCGGATTCCATGAGATGACAAAAGACTACAAAGTGTTGAAGATAGTTTACTTCAGAGGTAGTAGTAG
TAGCAATAATGGTATTTACAGAGGTCGTGGTAGAATCCAGTACAAGCAATCAGAGGTTCAGATCTTAACCTTGTCATCAA
AAACAACAGATCAATCTTTGTCTTGGAGAAGCTTAGGCAAAGCTCCTTATAAGTTTATGAAACGTTCGTCGGAGGCTTTG
GTCAACGGGAGGTTACATTTTGTGACAAGGCCTCGTAGGCACGTGCCGGATCGTAAGTTTGTGTCATTTGATCTTGAAGA
TGAAGAGTTTAAAGAAATTCCTAAACCAGACTGCGGTGGGCTAAACCGGACAAACCATAGACTAGTGAACCTTAAAGGGT
GTCTTTGTGCGGTCGTTTATGGTAACTATGGAAAATTAGACATATGGGTGATGGAGACTTATGGAGTCAAAGAATCATGG
GGAAAAGAGTATAGCATTGGGACTTACTTGCCAAAGGGGCTAAAGCAGAATCTGGACCGACCCATGTGGATTTGGAAGAA
CGCTGAGAATGGTAAAGTGGTTCGGGTTTTATGTTTGTTGGAGAATGGAGAGATCTTGTTGGAGTATAAGAGTAGGGTTC
TTGTGGCATATGATCCAAAATTGGGTAAATTTAAAGATCTTCTTTTCCATGGTTTGCCTAATTGGTTTCACACTGTTGTT
CATGTTGGAACATTGTCTTGGGTTGATACACCCCTTGATTTATGGTAA