Details for Lyrate rockcress Locus 16058663

Position : sca3 ( 5`- 7765260 .. 7767087 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058663

Protein [Map View]
MATNNGDVLMLEAAPEAARPWASAANAEVIDALPYIDDDYGNPLIKSEVDRLVEEEMRRSSKKPADFLKDLPPLPKFDFE
NCPVLGKEYERVRAGKPPVRIDFESRYKLELPPANKSNDAAAWKQYLQKNQRSLQQKLIELENLELMSKLGPELWRQNNH
RLEVFLTRMQRLAQEQNKEIEKVNRERKYHQQTTSYELNALSQEWRQLCVKNMEIQSACAMLETQMDSFKKEAAERGWNL
EEKLENVEPLQMQ*

DNA
ATGGCGACGAACAATGGGGACGTTTTGATGCTGGAGGCGGCGCCGGAGGCTGCGAGGCCATGGGCTAGTGCGGCGAATGC
AGAAGTTATCGATGCGCTTCCTTATATAGACGACGACTATGGCAATCCCTTGATTAAATCGGAGGTCGACCGCTTGGTGG
AGGAAGAGATGCGTCGGAGCTCTAAGAAGCCAGCTGACTTTCTCAAGGACTTGCCTCCTCTTCCGAAGTTCGATTTCGAG
AACTGCCCAGTTCTTGGCAAAGAGTATGAGCGTGTTCGAGCTGGGAAGCCTCCAGTGCGGATAGATTTTGAATCCCGATA
CAAGCTTGAATTGCCGCCTGCTAATAAGAGTAATGATGCTGCTGCCTGGAAGCAGTATCTTCAGAAGAATCAGCGGTCAT
TGCAACAGAAGCTGATCGAGCTTGAGAATTTGGAATTGATGTCAAAACTTGGCCCCGAGCTTTGGAGACAGAACAACCAT
CGGCTAGAAGTATTCTTGACCAGAATGCAAAGACTGGCGCAGGAGCAGAACAAGGAAATTGAAAAAGTAAATCGGGAAAG
GAAGTATCATCAGCAAACCACATCATACGAGCTCAATGCTCTATCTCAAGAATGGAGACAGCTCTGCGTGAAGAATATGG
AGATTCAGTCTGCTTGTGCCATGCTTGAGACACAGATGGATTCGTTTAAAAAAGAAGCTGCTGAAAGGGGATGGAACTTA
GAAGAGAAACTAGAGAACGTCGAGCCACTTCAAATGCAATGA