Details for Lyrate rockcress Locus 16058662

Position : sca3 ( 5`- 2860179 .. 2857880 -3` )
Annotation : [B2G] din3 lta1
External links : CoGe
PGDD synteny : 16058662

Protein [Map View]
MIARRIWRSQRFLRPFSSSSVCAPPFRVPEYLSQSSCSPASRPFFVHPPTLMEWCGGSRSWFSNEAMAIDSNSGLIDVPL
AQTGEGIAECELLKWFVKEGDPVEEFQPLCEVQSDKATIEITSRFKGKVALISHTPGDIIKVGETLVRLAVEDSQDSLLL
TSDSSEIINLGGSKQRTDNLVGALSTPAVRNLAKDLGIDINVITGTGKDGRVLKEDVLRFSDQKGFVTDSVSSEHAVIRE
DSVSTKASSNFGDKTVPLRGFSRAMVKTMTMATSVPHFHFVEEINCDSLVELKQFFKQNNTDSTIKHTFLPTLIKSLSMA
LTKYPFVNSCFNAESLEIILKGSHNIGVAMATEHGLVVPNIKNVQSLSLLEITKELSRLQHLATNNKLNPEDVTGGTITL
SNIGAIGGKFGSPLLNLPEVAIIALGRIEKVPKFSKEGTVYPASIMMVNIAADHRVLDGATVARFCCQWKEYIEKPELLM
LQMR*

DNA
ATGATCGCGCGACGGATCTGGCGGAGCCAGCGGTTTCTCCGCCCATTCAGCTCGTCATCTGTTTGCGCTCCGCCGTTCCG
GGTACCGGAGTATCTTTCTCAGTCGTCTTGCTCTCCGGCGTCGCGCCCATTCTTTGTTCACCCTCCCACTTTGATGGAAT
GGTGTGGAGGAAGTAGAAGCTGGTTTTCGAACGAAGCCATGGCCATTGATTCAAATTCAGGGTTAATTGATGTGCCACTT
GCACAAACTGGGGAAGGTATTGCTGAATGTGAGCTTCTCAAGTGGTTTGTCAAAGAGGGAGATCCGGTAGAAGAGTTTCA
GCCACTCTGTGAAGTTCAAAGCGATAAAGCAACAATAGAGATCACAAGTCGTTTTAAGGGCAAAGTGGCTCTGATTTCAC
ACACTCCAGGTGACATTATTAAGGTTGGAGAGACTCTGGTTAGGCTGGCGGTGGAAGACTCGCAGGATTCGCTTCTTCTA
ACCTCTGATAGTTCAGAAATTATAAATCTGGGCGGTTCAAAGCAGAGAACAGACAATCTTGTTGGAGCTCTCTCAACGCC
TGCGGTTCGTAACCTTGCAAAAGACCTTGGCATAGATATCAATGTCATAACTGGAACTGGTAAAGATGGAAGAGTTTTGA
AAGAAGATGTTCTCCGATTTAGTGACCAGAAAGGATTTGTAACAGATTCAGTTTCTTCTGAGCATGCTGTTATAAGAGAA
GACTCGGTTTCCACTAAAGCTAGTAGTAACTTTGGAGATAAAACTGTTCCTCTAAGGGGATTCAGCCGAGCAATGGTCAA
GACAATGACTATGGCTACAAGTGTACCGCATTTTCATTTCGTTGAAGAGATAAACTGCGACTCACTTGTGGAGCTCAAGC
AATTCTTTAAGCAGAACAATACAGATTCCACCATCAAACACACTTTCCTTCCTACGTTAATCAAGTCACTGTCAATGGCT
CTAACCAAATACCCCTTTGTGAATAGTTGCTTCAACGCAGAATCTCTCGAGATCATTCTCAAAGGTTCACATAACATTGG
AGTTGCAATGGCCACTGAACATGGCCTTGTTGTTCCTAATATAAAGAATGTACAGTCATTATCTCTGCTAGAGATAACCA
AGGAGCTGTCGCGGTTACAACATCTGGCAACAAACAACAAACTTAACCCCGAGGATGTGACTGGTGGAACCATAACTCTG
AGTAACATTGGAGCAATCGGTGGGAAATTCGGATCCCCTCTTTTAAACTTACCGGAAGTTGCAATCATCGCTCTTGGAAG
AATCGAGAAAGTTCCAAAATTCTCAAAAGAAGGAACAGTTTATCCTGCATCAATAATGATGGTTAACATTGCTGCGGATC
ATAGAGTTCTAGACGGGGCAACAGTCGCTCGGTTTTGCTGCCAGTGGAAAGAGTATATCGAGAAACCGGAGTTGCTGATG
CTTCAAATGAGATAA