Details for Lyrate rockcress Locus 16058654

Position : sca3 ( 5`- 5204193 .. 5206360 -3` )
Annotation : [B2G] dna binding protein
External links : CoGe
PGDD synteny : 16058654

Protein [Map View]
MEEKEEKKGSISMVEANLPPGFRFHPRDDELVCDYLMRRTVRSLYQPVVLIDVDLNKCEPWDIPQMARVGGKKWYFYSQK
DRKYTTGHRTNRATATGYWKATGKDRAIQRNGSLVGMRKTLVFYRGRAPKGRKTDWVMHEFRLQGTLLHHSSNSLKEEWV
LCRVFHKNSNGADRVDNTKSCSNETAPAFMDPYINFDHHIINQHVPCFSNNLSENQTNQSGLVSKNSSPLFNASPDQMII
RTLLSQLTKNVEKSESYGEGSSESQLTNIGIPSPTWNYYV*

DNA
ATGGAGGAAAAAGAAGAGAAGAAGGGCAGTATAAGTATGGTTGAGGCTAACCTACCTCCTGGTTTTAGGTTCCATCCTAG
AGACGACGAGCTCGTCTGCGACTACTTGATGAGAAGAACCGTTCGCAGCCTCTATCAACCAGTTGTCTTGATCGACGTCG
ATCTCAACAAGTGCGAGCCTTGGGACATTCCTCAAATGGCGAGAGTGGGAGGGAAAAAATGGTATTTTTACAGCCAAAAA
GATCGGAAATACACAACAGGCCACAGAACAAACCGGGCTACGGCCACCGGTTATTGGAAAGCCACCGGAAAAGATAGAGC
AATCCAAAGAAATGGTAGTCTGGTGGGTATGAGAAAGACACTTGTGTTTTACCGAGGTCGAGCCCCTAAAGGTCGTAAAA
CCGATTGGGTCATGCATGAGTTTCGTCTCCAAGGAACACTTCTTCACCACTCTTCTAATTCTCTCAAGGAAGAGTGGGTA
TTATGTAGAGTTTTCCATAAGAACAGCAACGGAGCTGATAGAGTCGACAACACAAAAAGCTGCTCTAATGAAACAGCTCC
TGCATTCATGGACCCTTACATTAACTTCGATCATCACATCATCAATCAGCATGTACCCTGCTTCTCCAATAATTTGTCAG
AGAACCAAACCAACCAATCCGGTCTAGTCTCCAAAAACTCCAGCCCGTTGTTTAATGCTTCCCCTGATCAAATGATTATC
CGAACTTTGCTAAGTCAACTCACAAAAAATGTCGAAAAATCAGAGAGTTATGGAGAAGGAAGCTCAGAGAGCCAATTGAC
CAACATTGGCATCCCAAGCCCTACATGGAATTACTATGTATAA