Details for Lyrate rockcress Locus 16058573

Position : sca2 ( 5`- 16513096 .. 16508246 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_895368 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058573

Protein [Map View]
MPISMELPVFSTLRVPLLSRLALVPTFGIPFSSLGASARLNCTARKARRICVMCLVRDSAPMETCERAGEDGSEFIEVVV
IGSRKESIIDSCLDSPFPSLPLRFWSISKDSSGDLVLQQRLSQQENASKTMNPIELIESRPRAFILVATAGYGSDQAEAI
NILSAVRTGGNLAVAVLLKPFSFEGRKRLEEVNELARKLQQHTNFCIDIDIEVLLQKDLVTLDEALRNANNAVSMAVNAA
SALISGMHVNFIDAMHKDLKELEGSEVKMILESYKEAKVGFGVGHNLKTSILRAIYDCPFFRPGLKDLNAIICVVASSAP
LQKKDVKTILRTFRQTMEYSGDIIVSTVHEPDLEPKVRVTTFFILSSSEEDTSIKGNIFSGLVPFVLNIFTRYRSQLQKE
TNSGLRETPVSIKGSADSIDVKSSNQNVEEFEIDSEDLLEISENGDSEYSLKEGGPSRNSRLDLEDENMEDFGAIQREPI
ANWSMDPGYQIEQKWPADSGDSAVLSLGIVNLPVGVRPSKKLNSTLGVASQPSRKADSREESFFNPNGSTKDSSDNASTL
LSEKYADFTKQRNLSARAASMLEAERDSSKRWSPILEMQYRGGLFKGRCQGGLPEGKGRLVLGDGSIYDGMWHNGKRSGL
GTFYFKNGDVFQGTWREDLIHGKGWFYFHKGDRWFANFWKGKASGEGRFYSKSGEIFFGHFKEGWRHGQFLCIDVDGTRY
SETWDDGVLIDRKQMDAGD*

DNA
ATGCCGATTTCTATGGAGCTTCCAGTTTTCTCCACTCTCCGAGTACCATTGCTCTCTCGTTTAGCTCTAGTTCCTACTTT
TGGAATTCCGTTTTCGTCCCTTGGTGCTTCGGCGCGATTGAATTGTACCGCTCGAAAGGCGCGTCGGATTTGCGTGATGT
GTTTGGTGAGGGATTCGGCTCCGATGGAGACATGCGAGAGAGCTGGAGAAGATGGGTCTGAGTTCATTGAGGTCGTTGTC
ATCGGTAGTCGCAAGGAGTCTATCATTGATTCTTGCTTGGATTCTCCTTTCCCTTCTCTTCCTCTCCGATTTTGGAGTAT
TAGCAAGGACAGCTCTGGAGATTTAGTGTTACAGCAGAGGCTCAGTCAGCAAGAGAATGCTTCGAAGACCATGAATCCAA
TTGAGCTGATAGAATCACGTCCAAGGGCCTTCATCCTTGTGGCTACTGCTGGATATGGCTCTGACCAGGCTGAAGCTATT
AATATTCTTAGTGCAGTAAGAACTGGGGGTAACTTAGCTGTTGCTGTGCTATTAAAGCCTTTCAGCTTTGAAGGCCGAAA
GCGTCTAGAAGAGGTTAACGAATTGGCTAGAAAACTGCAGCAACACACCAATTTCTGTATAGATATCGACATAGAGGTTT
TACTACAGAAGGATTTGGTAACTTTGGACGAGGCGCTGAGAAATGCAAACAATGCTGTTTCCATGGCAGTAAATGCAGCT
TCCGCTCTGATAAGTGGGATGCATGTAAACTTCATCGATGCGATGCATAAAGATCTCAAAGAACTTGAAGGTTCAGAAGT
AAAAATGATTCTAGAAAGCTACAAAGAGGCAAAGGTTGGTTTTGGAGTTGGTCACAACCTTAAGACTTCGATTTTACGAG
CTATATATGACTGCCCATTCTTTCGCCCTGGTCTAAAGGATCTAAACGCTATTATATGCGTTGTGGCTAGTTCAGCACCT
CTTCAGAAGAAGGACGTGAAAACAATTCTTCGTACTTTTCGTCAAACAATGGAGTATAGTGGAGATATTATAGTATCTAC
TGTTCATGAACCTGATCTGGAGCCTAAAGTGCGTGTCACAACGTTTTTTATTCTAAGTTCTTCAGAAGAGGATACATCCA
TCAAAGGCAACATTTTTTCTGGTCTTGTTCCTTTTGTTTTAAATATCTTCACGAGATATCGTTCACAGCTCCAAAAAGAA
ACAAATAGTGGACTTCGAGAGACTCCAGTTTCCATTAAAGGTTCAGCAGACTCTATTGACGTAAAAAGTTCGAATCAGAA
TGTTGAAGAATTTGAAATTGACTCTGAGGACCTCCTGGAAATTTCTGAGAACGGTGATAGTGAATACTCATTAAAAGAGG
GGGGACCATCCAGAAACAGTCGACTGGATCTTGAAGATGAAAATATGGAAGATTTTGGTGCTATCCAGAGAGAGCCAATT
GCCAATTGGAGTATGGATCCGGGATATCAGATTGAGCAGAAATGGCCAGCTGATTCTGGAGACTCTGCAGTGCTTAGCCT
GGGCATTGTCAACCTTCCTGTTGGGGTGAGACCTTCAAAGAAGTTGAACAGTACTCTTGGTGTTGCCAGCCAACCCTCTC
GAAAGGCTGATTCCAGAGAAGAATCATTTTTCAACCCTAATGGGTCGACAAAAGACTCTAGTGATAATGCATCTACCCTG
CTATCTGAGAAATATGCTGATTTTACAAAGCAAAGAAATCTATCCGCTCGAGCAGCGTCTATGCTGGAAGCTGAACGAGA
TTCATCAAAGAGATGGAGCCCTATTCTCGAGATGCAGTACAGAGGAGGACTTTTCAAGGGAAGATGCCAAGGAGGCCTTC
CCGAAGGAAAGGGTCGTTTGGTACTTGGAGATGGAAGCATATATGATGGAATGTGGCACAACGGCAAAAGATCTGGTCTT
GGAACATTCTACTTCAAGAATGGAGACGTGTTCCAAGGCACATGGAGAGAAGATTTAATACACGGAAAGGGTTGGTTTTA
TTTCCACAAAGGTGATCGATGGTTTGCAAATTTCTGGAAAGGAAAAGCCAGTGGCGAAGGCCGGTTCTATTCGAAGTCCG
GTGAGATATTCTTTGGACATTTCAAAGAGGGATGGCGACACGGACAATTCCTCTGTATAGATGTGGATGGTACAAGATAC
TCTGAAACTTGGGACGACGGTGTTCTTATTGACCGGAAACAAATGGATGCCGGAGATTGA