Details for Lyrate rockcress Locus 16058363

Position : sca3 ( 5`- 7656238 .. 7661316 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058363

Protein [Map View]
MAIVTGDRYLETLQKFLEEKADLLIDGTDVLKLNPAGLHYVHLRLESLRELELMLSGAPVDYLRAYVSDIGDFRALEQLR
RILRLLPSLKVVSSLPSPARDPTPLSLLPFSKLKVLELRGCDLSTSSAKGLLELRHTLEKLICHNSTDALRHVFASRIAE
IKDSPQWNKLAFISCACNRLVLMDESLQLLPAVESLDLSRNKFAKVDNLRRCTKLKHLDLGFNQLRKISHLSEVSCHLVK
LVLRNNALTTLRGIENLKSLEGLDVSFNLISDFSELEVLGSLSFLTDLWLEGNPICCARWYRAHVLSYVSLPNDLKLDGK
HIGNREFWKRQVVVTRRKSQPASYGFYSPARDEADDEGSCNRKKTKIYRLASIDSEEESTYVNSDQESASCEPETQSKEE
NIKSDHEADVFGLISKVEQLKKERSVLWLREFKEWIDHPSEDFVDVSKNGSSTDSEQKYDTKNRNGPKHYGETMRYAPGP
LPGFQITDLNQKHQAFFLDGKPDENGNMSTSDATQDMTGSFSPSSPPHYQKDVLHRRQNLVEEILQISADSYSVASSDSS
CSENENYDSEQSNPEQDMLKDHLSGNRGEDTSLLDSQPEKSSIIKSWRIEDSFKAKTTNFLSGLHNSELASGVNQIYRWF
DKRKSKRKPKKRVISPLEENSFINNGETSHRSDANIIDSCEDEYISDHFQEGSLTTGCNSKRSTRFLETEKSLEGMDGLV
EEFFTTTLSDSSINETCRIYVSCDCIIQQESTYKQREVVLLLSSQEKLYVLLVGVSSDSQESSLSLLCSHTIGDIQDVSV
GLGLQVVRLRFREDAEYIFITASIEKTTVLLNIIKLLDSQVTESKFSLKSLENVQVELFEKEICSGLKLSIFQYNVLHFQ
SSTLGEVSWLPRSLFVAGGHLFICNEDFRQLSFLPTDASSSPYFSLASSCSISDIFEMVVESRGSSCLSLKIKQMDSTFQ
SKQKRTVNSVTWKLKLLSNECVLKFVALINGLHPESTECPLLVRHLGEK*

DNA
ATGGCAATCGTTACCGGAGATCGATATCTAGAGACTCTCCAGAAGTTTCTTGAAGAGAAAGCTGATTTGCTTATTGATGG
TACCGATGTTCTCAAGCTTAATCCCGCAGGCCTTCACTATGTTCATCTCCGTCTCGAATCTCTTCGTGAACTTGAGCTTA
TGCTCTCCGGAGCTCCCGTTGACTATCTCCGCGCCTACGTCTCCGACATTGGCGATTTTCGTGCCCTTGAGCAGCTCCGA
CGTATTCTCCGCCTCCTTCCTTCTCTCAAGGTCGTTTCGTCGCTTCCTTCACCGGCTCGTGATCCTACGCCGCTATCTCT
TCTTCCTTTTTCTAAGCTTAAGGTCTTGGAACTCCGTGGGTGTGATTTGTCTACTTCTTCTGCCAAAGGCTTGCTCGAAC
TCAGGCACACCTTGGAGAAGTTGATCTGCCATAATTCCACTGATGCGCTTCGGCATGTGTTTGCTAGTAGAATCGCCGAG
ATAAAGGATTCACCTCAGTGGAATAAGTTGGCTTTCATTTCTTGTGCTTGTAACCGTCTTGTTCTCATGGATGAGTCGTT
GCAACTTCTTCCAGCTGTTGAGTCCCTTGATCTTAGCCGAAACAAGTTTGCAAAGGTAGATAATCTTCGGAGATGTACCA
AGTTGAAACACCTTGATCTGGGTTTCAATCAACTTAGAAAAATCTCTCACCTGAGCGAGGTATCCTGTCACCTTGTTAAA
CTTGTTTTGAGGAATAACGCGCTAACTACATTGCGTGGGATTGAGAATTTGAAGTCACTTGAAGGCCTTGATGTTTCCTT
CAATCTTATTTCCGACTTTTCAGAACTGGAAGTTCTTGGGAGTCTTTCATTCTTGACAGACCTGTGGTTGGAAGGAAATC
CAATTTGCTGTGCTCGATGGTACAGAGCACATGTCCTCAGCTACGTTTCTCTTCCAAATGATTTGAAGCTAGATGGCAAA
CATATTGGGAATAGAGAATTTTGGAAGAGGCAGGTTGTTGTTACCCGTAGGAAAAGTCAGCCTGCCAGTTACGGGTTCTA
CTCTCCGGCTAGAGACGAAGCTGATGACGAAGGAAGCTGTAATAGAAAAAAGACGAAAATCTACCGGCTCGCGTCTATTG
ATAGTGAGGAAGAGAGCACCTATGTGAATTCTGATCAAGAGTCTGCTTCATGTGAACCCGAGACTCAAAGCAAAGAAGAG
AATATCAAGTCTGATCATGAAGCTGATGTCTTTGGTCTAATAAGTAAAGTTGAACAGTTGAAGAAAGAGCGTTCTGTTCT
CTGGCTTCGGGAATTTAAGGAGTGGATAGATCATCCATCAGAGGATTTTGTGGATGTCAGCAAAAATGGGAGCAGTACTG
ATTCAGAGCAAAAGTACGACACGAAGAATAGAAATGGCCCAAAGCATTATGGTGAAACAATGAGATATGCACCAGGGCCT
CTACCAGGTTTCCAAATTACAGATCTAAATCAGAAGCATCAAGCATTTTTTCTTGATGGGAAGCCAGATGAAAATGGAAA
CATGTCAACTTCGGATGCTACTCAGGATATGACAGGATCATTTTCACCCTCATCACCCCCTCATTATCAAAAGGATGTCT
TACACCGGCGTCAGAACCTGGTGGAAGAAATCTTACAGATATCAGCAGATTCTTATTCAGTGGCTTCGTCTGATAGTAGC
TGCAGTGAAAATGAAAATTATGATTCTGAGCAATCAAATCCTGAACAGGATATGTTGAAGGATCATCTTAGTGGGAATAG
AGGAGAAGACACAAGCTTGCTTGACTCTCAACCAGAGAAGAGTAGCATCATAAAGTCTTGGAGGATAGAGGATTCGTTCA
AAGCAAAGACCACTAATTTTCTTTCTGGGCTACATAATAGTGAGCTTGCTTCTGGTGTTAACCAGATTTACCGTTGGTTT
GACAAAAGGAAAAGCAAGAGGAAGCCTAAAAAAAGAGTTATTTCTCCACTGGAGGAGAATAGTTTCATAAATAATGGAGA
AACATCTCATAGAAGTGATGCAAATATCATTGATTCTTGTGAAGATGAATATATTTCTGATCATTTTCAAGAAGGTTCCT
TGACTACGGGTTGTAATAGTAAGAGAAGTACTAGATTTTTGGAAACTGAAAAATCCCTTGAAGGAATGGATGGTCTAGTG
GAAGAATTTTTTACAACGACACTGTCAGATTCCAGCATTAATGAGACTTGTAGGATTTACGTTAGTTGTGATTGCATAAT
ACAGCAAGAATCCACTTACAAGCAACGGGAAGTAGTGTTGCTGCTGAGTAGCCAAGAAAAACTGTATGTGCTGCTCGTGG
GTGTCTCCAGTGATTCACAAGAGAGCAGTTTAAGTTTATTGTGTTCGCATACAATCGGTGATATACAAGACGTCTCAGTT
GGTCTAGGACTTCAGGTTGTGAGGCTACGCTTTAGGGAGGATGCAGAGTACATTTTCATAACGGCGAGCATTGAAAAAAC
AACAGTTTTACTCAATATCATAAAATTATTGGATTCTCAGGTTACAGAATCAAAATTTTCTTTGAAGAGTTTGGAGAATG
TTCAAGTGGAATTGTTTGAGAAAGAAATATGTAGTGGTTTGAAGCTGAGTATATTCCAGTATAATGTTCTCCATTTTCAG
AGCAGCACTCTTGGAGAAGTGTCATGGCTTCCACGGTCACTCTTTGTGGCGGGTGGACATCTTTTCATATGCAATGAAGA
CTTCAGGCAGCTGAGTTTTCTGCCAACAGATGCTTCTTCATCCCCATATTTCTCACTTGCCTCAAGCTGCTCAATCTCCG
ACATATTTGAGATGGTTGTTGAATCACGAGGAAGCTCGTGCTTGTCACTGAAGATCAAGCAGATGGATTCCACATTTCAA
AGCAAACAAAAGAGGACAGTGAATTCAGTAACATGGAAGCTCAAGTTACTCAGCAACGAGTGTGTACTCAAATTTGTGGC
TCTAATCAATGGACTTCACCCAGAATCGACAGAATGCCCGTTGCTCGTAAGGCATTTGGGTGAGAAATGA