Details for Lyrate rockcress Locus 16058353

Position : sca3 ( 5`- 10082924 .. 10082592 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058353

Protein [Map View]
MEIESVRCECCGLMEDCTQDYISEVKSNFDNKWLCGLCSEAVRDEVSRRKMTTVDEAVKAHVSFCGKFKKDNPAVHVADG
MRQMLRRRSGDLTTSSTSKKFGRSNTTKLY*

DNA
ATGGAGATTGAATCTGTGAGATGCGAGTGTTGTGGGTTAATGGAAGATTGCACACAAGACTACATTAGTGAGGTCAAATC
TAACTTCGACAACAAATGGCTTTGTGGTCTCTGCTCTGAGGCCGTGAGGGACGAAGTGAGTCGCCGGAAGATGACCACCG
TTGATGAAGCCGTTAAGGCCCACGTGTCGTTTTGTGGCAAGTTCAAAAAAGATAATCCGGCGGTTCATGTGGCCGACGGT
ATGAGGCAGATGCTACGTAGGAGGTCCGGTGACTTGACGACTTCCTCTACGTCCAAGAAGTTTGGTAGATCTAACACCAC
CAAGTTGTACTGA