Details for Lyrate rockcress Locus 16058348

Position : sca3 ( 5`- 5166579 .. 5167795 -3` )
Annotation : [B2G] transcription factor
External links : CoGe
PGDD synteny : 16058348

Protein [Map View]
MEKMIESRDNTRESEDEEVLKLPGFRFHPTDEELVGYYLSKKVLLKKPSKIDEIVSQIDIYKFDPWDLPRSRNTEKESYF
FCKRGRKYRNSIRPNRVTGSGFWKATGIDKPIYSDGSNKAVIGLKKTLVYYLGSAGKGSKTDWMMHEFRLPTANDTIPGG
PTHSNPTPTSLLHAEVWTLCRIFKRNVSSRKYTPDWRELANGKRVKQQQSNYQEAYYINFGDYESSSTNVINVREGEGNY
ERSVFQLQQTPHQHQNKPILMDTTHVDNSFQHFSNDNIHEETYENWDELRSVVEFAFPPSSLS*

DNA
ATGGAGAAGATGATAGAATCACGGGACAACACAAGAGAATCAGAAGATGAGGAAGTGTTAAAGCTTCCAGGGTTTAGGTT
TCATCCAACGGACGAGGAGCTTGTAGGGTATTATCTCTCTAAGAAAGTACTTCTAAAAAAACCAAGCAAGATCGATGAGA
TTGTTAGCCAAATCGATATCTATAAATTCGATCCGTGGGATCTTCCAAGGTCGAGGAATACGGAGAAGGAAAGCTACTTC
TTCTGCAAGAGAGGAAGGAAATATAGAAACAGCATAAGACCGAACCGAGTGACTGGTTCCGGTTTCTGGAAAGCCACAGG
GATAGACAAGCCTATCTATTCCGATGGATCCAATAAAGCCGTGATCGGTCTAAAGAAGACACTCGTTTATTACCTTGGAA
GCGCCGGGAAAGGAAGCAAGACGGATTGGATGATGCACGAGTTTCGTCTCCCCACAGCCAATGACACTATCCCCGGTGGC
CCTACACACTCTAACCCTACTCCAACTTCCTTGCTACACGCAGAAGTATGGACGTTATGTCGGATATTCAAGAGAAATGT
GTCTAGTAGAAAATACACTCCAGACTGGAGAGAATTAGCAAATGGCAAACGCGTGAAGCAGCAACAATCTAATTACCAAG
AAGCTTATTATATAAATTTTGGGGACTATGAAAGTAGTAGTACCAATGTGATCAACGTAAGGGAAGGCGAAGGGAATTAC
GAGAGAAGCGTTTTCCAGCTTCAACAAACGCCTCATCAACATCAAAACAAGCCAATTCTCATGGACACCACACACGTTGA
TAATTCGTTTCAACATTTCTCCAACGATAACATTCACGAAGAAACCTACGAGAATTGGGACGAGCTTCGATCGGTTGTGG
AATTTGCTTTCCCACCTTCTTCTCTTAGTTAG