Details for Lyrate rockcress Locus 16058285

Position : sca3 ( 5`- 1438368 .. 1434086 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_477686 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058285

Protein [Map View]
MSLLFLNPPFPSNSIHTIPRRAAGLSSIRCSISAPEKKPRRRRKQKRGDGAENDSSLSFGSGDAVSALERSLRLTFMDEL
MERARNRDTSGVSEVIYDMIAAGLSPGPRSFHGLVVAHALNGDEHGAMHSLRKELGAGQRPLPETMIALVRLSGSKGNAT
RGLEILAAMEKLNYDIRQAWLILVEELMRINHLEDANKVFLKGARGGMRATNHLYDLMIEEDCKAGDHSNALEISYEMEA
AGRMATTFHFNCLLSVQATCGIPEVAYATFENMEYGEGLFMKPDTETYNWVIQAYTRAESYDRVQDVAELLGMMVEDHKR
VQPNVKTYALLVECFTKYCVVKEAIRHFRALKNFEGGTTILHNAGKFEDPLSLYLRALCREGRIVELIDALDAMRKDSQP
IPPRAMIMSRKYRTLVSSWIEPLQEEAELGYEIDYVARYIEEGGLTGERKRWVPRRGKTPLDPDASGFIYSNPIETSFKQ
RCLEDWKIHHRKLLRTLQSEGLPVLGDASESDYMRVMERLRNIIKGPAQNLLKPKAASKMVVSELKEELEAQGLPIDGTR
NVLYQRVQKARRINKSRGRPLWVPPIEEEEEEVDEEVDDLICRIKLHEGDTEFWKRRFLGEGLIETSVESKETTESVVTG
ESEKAIEDISKEADNDEDDDEEEQEGDDDDDETEEEEEVVVAETENRAEGEELVKNKAADAKKHLQMIGVQLLKESDEAN
RTKKRGKRASRMTLEDDADEDWFPEDPFEAFKEMRERKVFDVSDMYTIADVWGWTWEKDFKNRTPRKWSQEWEVELAIVL
MTKARVIELGGIPTIGDCAVILRAALRAPMPSAFLKILQTTHSLGYSFGSPLYDEIITLCLDIGELDAAIAIVADMETTG
ITVPDQTLDKVISARQSNENPRSEPEEPPSTVSS*

DNA
ATGTCACTCTTGTTCCTCAATCCTCCGTTTCCCTCCAATTCAATCCACACAATTCCTCGTCGCGCCGCCGGATTATCCTC
CATTAGGTGCTCAATTTCTGCACCGGAGAAGAAGCCAAGGAGGAGGAGGAAGCAGAAGCGCGGCGACGGAGCTGAGAATG
ACTCCTCCTTGTCTTTCGGAAGCGGTGATGCTGTCTCGGCCCTGGAGAGGAGTCTCCGCCTCACTTTTATGGACGAGCTT
ATGGAACGAGCTAGGAATCGAGATACTTCAGGTGTATCTGAGGTTATCTATGACATGATTGCTGCTGGGCTTAGCCCTGG
ACCTCGTTCTTTCCATGGCTTGGTCGTAGCTCACGCGCTTAACGGCGACGAACATGGCGCGATGCACTCGTTGAGAAAGG
AGCTAGGTGCAGGCCAACGTCCGCTTCCTGAAACTATGATTGCTTTGGTTCGACTCTCGGGTTCGAAAGGAAATGCTACA
AGAGGCTTAGAAATTCTCGCCGCTATGGAAAAGCTTAACTATGACATTCGTCAAGCTTGGCTCATTCTTGTTGAGGAGCT
CATGAGGATCAATCACTTGGAAGATGCGAATAAAGTTTTCTTGAAGGGTGCTAGAGGTGGGATGAGAGCAACAAATCATC
TTTATGATCTGATGATTGAAGAAGATTGCAAAGCGGGAGATCACTCTAATGCCTTAGAAATCTCTTACGAAATGGAGGCA
GCTGGTAGAATGGCGACAACATTTCATTTCAATTGTCTTCTTAGTGTGCAGGCTACATGTGGGATTCCCGAGGTTGCTTA
TGCTACATTCGAAAATATGGAGTACGGTGAAGGTTTATTTATGAAGCCTGACACTGAGACATATAACTGGGTGATTCAAG
CCTACACTAGAGCCGAGTCATATGATAGGGTTCAGGATGTTGCTGAATTACTTGGAATGATGGTTGAGGACCACAAACGT
GTGCAACCAAATGTGAAGACTTATGCGCTCTTAGTTGAGTGCTTCACGAAATATTGTGTTGTGAAGGAAGCGATTAGACA
TTTTCGTGCACTTAAAAACTTTGAAGGAGGAACAACAATTTTACACAATGCAGGGAAATTTGAGGATCCTCTCTCTTTGT
ATCTCAGGGCTTTGTGTCGAGAAGGAAGAATTGTTGAGCTTATTGATGCTTTAGATGCAATGCGCAAAGATAGCCAACCT
ATACCTCCAAGAGCCATGATTATGAGCAGAAAGTATCGGACACTAGTCAGCTCATGGATTGAACCATTGCAAGAAGAAGC
TGAACTTGGCTATGAGATTGATTATGTAGCGAGGTACATAGAGGAAGGGGGACTTACTGGTGAGCGCAAGCGTTGGGTAC
CTCGAAGAGGGAAAACTCCTTTAGATCCTGATGCTTCTGGTTTTATATACTCAAACCCTATTGAGACATCCTTTAAACAG
AGATGCCTTGAAGATTGGAAAATTCACCATAGGAAGCTCTTGAGAACCTTACAGAGTGAAGGTCTTCCAGTTCTAGGAGA
TGCATCAGAATCTGATTACATGAGAGTGATGGAGAGATTACGGAACATAATAAAAGGTCCTGCACAGAATCTTTTGAAGC
CGAAAGCAGCAAGCAAGATGGTTGTATCAGAGTTAAAGGAAGAACTCGAAGCTCAGGGTTTGCCAATTGATGGAACAAGA
AATGTGCTTTACCAGCGTGTCCAAAAAGCAAGGAGAATAAACAAATCTCGAGGTCGACCTCTTTGGGTTCCTCCAATTGA
AGAAGAAGAGGAGGAGGTCGATGAAGAAGTAGACGATTTAATATGTCGAATCAAGCTACATGAAGGAGACACAGAGTTCT
GGAAACGTCGGTTTCTTGGAGAAGGCTTGATTGAAACTTCAGTTGAATCCAAGGAAACGACTGAATCAGTGGTTACAGGT
GAGTCGGAGAAAGCGATTGAAGATATTTCAAAAGAAGCTGACAATGATGAGGATGATGATGAGGAGGAACAAGAAGGAGA
TGATGATGATGACGAAACTGAAGAGGAAGAGGAAGTGGTTGTTGCAGAAACAGAGAATCGAGCAGAAGGAGAGGAGTTAG
TGAAGAATAAGGCAGCTGACGCGAAGAAGCATCTTCAAATGATTGGAGTCCAACTCTTGAAAGAATCCGATGAAGCAAAC
AGAACAAAGAAACGTGGGAAGAGGGCGTCTCGTATGACACTTGAGGATGATGCAGATGAGGATTGGTTCCCAGAGGACCC
ATTCGAAGCATTCAAAGAAATGAGGGAAAGAAAAGTGTTTGATGTGTCTGACATGTATACAATAGCAGACGTTTGGGGTT
GGACATGGGAAAAGGATTTTAAGAACAGAACTCCTAGGAAATGGTCACAAGAGTGGGAAGTCGAGTTGGCAATTGTGCTA
ATGACAAAGGCAAGAGTGATTGAACTGGGTGGAATTCCAACAATTGGTGATTGTGCAGTGATATTACGAGCTGCTTTAAG
AGCTCCCATGCCTTCAGCCTTCTTGAAGATCTTGCAGACGACACACAGTCTTGGCTACTCTTTTGGCAGCCCATTGTACG
ATGAGATCATCACATTGTGTTTAGACATTGGAGAACTTGATGCAGCCATTGCCATAGTTGCAGATATGGAAACCACAGGG
ATCACTGTCCCTGATCAAACCCTTGACAAGGTCATATCTGCTAGACAATCTAATGAGAATCCGCGGTCTGAGCCTGAAGA
GCCACCATCAACAGTAAGCTCTTAG