Details for Lyrate rockcress Locus 16058270

Position : sca3 ( 5`- 10259762 .. 10261014 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_479795 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058270

Protein [Map View]
MERRQAKIHVFVLIGLILLNSINQISSLSVTVNDEECVQEYVLYEGDTVSGNFVVVDHDIFWGSDHPGLDFTVTSPAGNI
VQTLKGTSGDKFEFKAPRSGMYKFCFHNPYSTPETVSFYIHVGHIPNEHDLAKDEHLDPVNVKIAELREALESVVAEQKY
LKARDTRHRHTNESTRKRVILYTVGEYIFLAAASGLQVLYIRKLFSKSVAYNRV*

DNA
ATGGAGAGAAGACAAGCGAAGATCCATGTCTTTGTATTGATTGGTTTGATTCTATTGAATTCGATCAATCAAATCTCGTC
GCTCTCTGTAACAGTTAACGACGAAGAATGTGTCCAAGAATACGTCCTTTACGAAGGCGACACTGTTTCCGGTAACTTCG
TCGTCGTCGATCATGATATATTCTGGGGATCAGATCATCCTGGTTTGGATTTCACGGTGACGTCTCCAGCTGGGAACATT
GTACAAACTTTAAAGGGAACATCTGGAGATAAGTTTGAGTTTAAGGCTCCAAGAAGTGGAATGTATAAATTTTGTTTCCA
CAATCCTTATTCTACTCCTGAAACTGTCTCCTTTTATATTCATGTTGGCCATATTCCCAATGAGCATGACTTAGCCAAAG
ATGAACATTTGGACCCGGTAAATGTTAAGATAGCTGAGTTGAGAGAGGCTTTGGAATCTGTTGTTGCTGAGCAGAAGTAT
TTGAAAGCACGTGATACTCGTCACCGTCATACGAATGAAAGCACGAGAAAGCGTGTGATATTGTACACAGTAGGAGAGTA
CATATTCCTTGCAGCAGCTAGTGGACTTCAAGTTCTCTACATCCGCAAGCTCTTTAGCAAGTCGGTCGCATACAACAGAG
TTTGA