Details for Lyrate rockcress Locus 16058263

Position : sca5 ( 5`- 17981298 .. 17983772 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058263

Protein [Map View]
MATRRLRAFKRWMKANGVDCSDALNLVDDQNDGVSVRAFCDLKEGDVVANISKTACLTIKTSGAREMIESADLDGSLGLS
VALMYERSLGEESPWAGYLQILPVQEDLPLVWSLQDLDSLLSGTELHKVVKEDHVLIYEDWKENILPLTSSLPQNVDSDS
FGIKEYLAAKSLIASRSFQIDDYHGSGMVPLADLFNHKTGAEDVHFTHESDTEADESENDDAANEATDEDDPSSKISSSP
EQSFEDVPGENTDDEAKEEEEEDDENSSMLQNDQSGLKMIMVKDVSAGTEVFNTYGLMGNAALLHRYGFTEFDNLYDIVN
IDLELVTEWSTSSFTSRYTRARLALWRKLGYTGCESQNSEYFEVSSTGEPQTELLILLYILLLPDDTYNKLDLAESTTGA
SLSKEGRETSSSSYEITIGKHKFVFGQSGNDILLTDGVCEALLTIVDKRESLYGSLNSLEDDIVRLKTCCLPRDRRVYHS
LVLRVSERKILKKLRSYIHTKANEFSGGKRRKKMLPKS*

DNA
ATGGCCACAAGGAGGTTAAGAGCATTCAAGAGATGGATGAAAGCTAACGGAGTTGATTGCAGCGACGCTCTCAACCTCGT
CGACGACCAAAACGATGGTGTCTCTGTGAGAGCATTCTGCGATTTGAAGGAAGGAGATGTTGTTGCCAATATCTCAAAAA
CTGCTTGTCTCACTATCAAAACCAGTGGAGCTCGTGAGATGATCGAATCTGCTGATTTAGATGGAAGTTTAGGTCTCTCT
GTGGCTCTCATGTACGAGAGAAGCTTAGGTGAAGAATCTCCTTGGGCTGGTTACCTTCAGATTCTTCCTGTTCAAGAAGA
TTTGCCTCTTGTTTGGTCTCTTCAAGACTTGGATTCTCTCTTATCTGGAACTGAGCTTCATAAGGTGGTGAAGGAAGATC
ATGTTCTTATATATGAAGATTGGAAAGAAAACATATTGCCACTTACCTCTTCACTGCCTCAGAATGTTGATTCTGATTCG
TTTGGAATTAAAGAGTATCTTGCTGCGAAGAGTTTAATTGCTTCACGGTCTTTCCAGATCGATGACTATCATGGATCAGG
GATGGTTCCTCTTGCAGATCTCTTCAATCATAAAACTGGGGCAGAAGACGTTCATTTCACTCATGAATCCGATACTGAAG
CTGATGAATCTGAAAACGATGATGCTGCAAATGAGGCCACCGATGAAGACGACCCTTCCAGTAAAATTTCTTCCTCGCCT
GAGCAGTCTTTTGAGGACGTTCCTGGTGAAAACACTGATGACGAAGCCAAAGAAGAAGAAGAAGAAGACGACGAAAACTC
TTCAATGCTGCAAAATGATCAATCCGGTCTAAAAATGATTATGGTGAAGGATGTCTCAGCTGGAACTGAGGTATTCAATA
CATACGGTTTGATGGGTAATGCTGCGTTACTCCACAGGTACGGATTTACAGAGTTCGATAATCTATACGACATAGTAAAC
ATAGATCTAGAATTAGTAACCGAATGGAGCACATCCTCATTCACAAGCCGGTACACTCGAGCTAGACTGGCCTTGTGGAG
AAAACTAGGCTACACAGGATGCGAGAGTCAAAACTCAGAATACTTCGAGGTATCTTCAACCGGAGAACCCCAAACCGAGC
TCCTGATCCTACTCTATATACTGCTCTTACCAGATGACACATACAATAAACTGGATCTAGCTGAATCAACAACAGGAGCG
TCTCTCTCCAAAGAAGGAAGAGAAACTTCTTCTTCTTCTTACGAGATAACAATTGGGAAACACAAGTTTGTGTTTGGACA
AAGCGGAAACGATATTCTTCTGACAGATGGTGTTTGTGAAGCTCTTCTAACTATTGTGGATAAGCGAGAGAGCTTATATG
GATCATTAAACTCATTGGAAGATGACATTGTTAGGCTCAAGACTTGTTGTCTTCCGAGAGACAGGAGAGTATATCATTCG
CTTGTGTTGCGTGTGAGTGAGAGGAAGATTCTAAAGAAGCTTAGGAGCTACATTCATACAAAGGCCAATGAGTTTTCCGG
CGGAAAGCGCCGGAAGAAGATGCTTCCAAAATCCTAG