Details for Lyrate rockcress Locus 16058216

Position : sca3 ( 5`- 8899462 .. 8898018 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058216

Protein [Map View]
MTWSVFRSINSPTLDLSTALRSTRTPLVAAGVGCATFAGVSLFRMSSRSPPFASLSVSASSVKKEVVATEKAPAALGPYS
QAIKANNLVFLSGVLGLIPETGKFVSESVEDQTEQVLKNMGEILKASGADYSSVVKTTIMLADLADFKTVNEIYAKYFPA
PSPARSTYQVAALPLNAKIEIECIATL*

DNA
ATGACTTGGTCGGTTTTCAGATCCATAAACTCTCCAACACTCGACCTCTCAACCGCACTTCGCTCCACTCGTACCCCATT
GGTCGCTGCTGGTGTCGGCTGCGCAACATTTGCTGGTGTTTCTCTCTTCAGAATGTCTTCTAGATCTCCTCCTTTCGCTT
CCCTCAGTGTCTCTGCTTCTTCTGTGAAGAAGGAAGTTGTGGCTACTGAGAAAGCACCAGCTGCTTTGGGACCATACTCT
CAGGCCATTAAAGCCAATAATCTTGTTTTCCTTTCAGGTGTTCTTGGACTTATACCTGAGACTGGAAAGTTTGTTTCCGA
GAGCGTCGAAGATCAGACTGAGCAGGTACTCAAAAACATGGGGGAGATATTGAAAGCTAGTGGTGCTGATTATTCCTCGG
TGGTGAAGACAACAATCATGTTGGCTGATTTGGCTGACTTCAAGACAGTGAACGAGATATATGCCAAATACTTCCCAGCT
CCCTCTCCAGCACGATCTACGTATCAAGTTGCAGCTTTGCCTCTAAACGCCAAGATCGAGATTGAATGTATTGCAACACT
CTAG