Details for Lyrate rockcress Locus 16058196

Position : sca3 ( 5`- 3301405 .. 3303554 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058196

Protein [Map View]
MGTWKTKNSNKKKKVSYISVPAQIINSVSSSSLQSFLDNKSSSKFFFNLRNPKLWAFSLFLLSILGISLRLGLCLSSGVH
ESQLQSSDSNGSPKSHLGFAYSRSNTTQVEISNAKDRSLDTGVEKNETFGGDQSHLITSSGNVHDDKNYEFWKQPDGLGY
KPCLDFSIEYRRESKKIVAERRKYLMVVVSGGLNQQKIQIVDAVVIARILGAVLVVPILQINLIWGDESEFSDIFDLEQF
KSVLVNDVKIVSLLPASKVMTRPSEDGSMPFNASPQWIRSHYLKRFNREGVLLLRRFDSRLSKDLPSDLQKLRCKVAFEA
LKFSPRVLDMGTKLAERMRSKGPYIALHLRMEKDVWVRTGCLSGLSSKYDEIVNIERIKRPELLTAKSSMTSNERKLAGL
CPLNAKEVTRLLRALGAPRDARIYWAGGEPLGGKEALKPLTSEFPHLYNKYDIALPLELKPFAKRASIMAAIDYIVCKES
DVFMASHGGNMGHAIQGHRAYEGHKKIITPNKRHMLPYFVNSSMTKTEFEKMIKKLHRQSLGQPELRISKAGRDVTKYPV
PECMCNQSNTTI*

DNA
ATGGGAACATGGAAGACGAAAAACAGTAATAAGAAGAAGAAAGTTAGCTACATTTCAGTCCCAGCTCAGATCATAAACTC
AGTTTCATCATCATCTTTACAAAGTTTTCTCGATAACAAATCTTCAAGCAAATTCTTCTTCAATCTCAGAAACCCAAAGC
TCTGGGCTTTCTCTCTCTTCTTACTTTCTATTTTGGGAATATCATTAAGACTCGGTCTTTGTCTTTCTTCCGGCGTTCAC
GAAAGTCAACTTCAGAGCTCGGATTCTAATGGGTCACCCAAATCCCATCTGGGTTTTGCGTATAGCCGATCAAACACCAC
TCAAGTTGAGATTTCGAACGCCAAGGATCGATCTTTAGATACGGGTGTGGAGAAAAATGAAACCTTTGGTGGTGATCAGT
CACATTTGATCACCTCTAGTGGAAATGTACATGATGATAAGAATTATGAGTTCTGGAAACAGCCTGATGGATTAGGTTAC
AAGCCATGCTTAGATTTCAGCATTGAATACAGAAGAGAGAGTAAGAAGATTGTTGCAGAGAGGAGAAAGTATCTGATGGT
GGTAGTTTCTGGTGGGTTGAATCAGCAGAAGATTCAGATTGTTGATGCAGTTGTGATTGCGAGGATTCTAGGTGCTGTTC
TTGTTGTCCCAATATTGCAAATCAATCTCATTTGGGGTGACGAGAGTGAGTTTTCAGATATATTTGATTTAGAGCAATTC
AAGAGTGTTTTAGTAAATGATGTGAAGATTGTTTCGTTGCTTCCCGCAAGTAAAGTAATGACTAGACCATCAGAAGATGG
TAGTATGCCCTTTAATGCCTCCCCTCAATGGATCCGTTCGCACTATCTAAAGCGTTTCAATAGGGAAGGAGTTCTGCTTT
TAAGGAGATTTGATTCAAGATTGTCTAAAGACTTACCCTCTGATCTCCAGAAGCTCCGTTGTAAGGTAGCATTTGAAGCA
CTAAAATTTTCGCCACGGGTTTTGGATATGGGGACGAAGCTTGCAGAGAGGATGAGGAGCAAAGGACCTTACATTGCGTT
GCATCTTCGGATGGAGAAAGATGTGTGGGTGAGAACAGGCTGCCTTTCTGGTTTGAGCTCAAAGTATGATGAGATTGTTA
ACATTGAAAGGATTAAGCGGCCTGAGCTCTTAACAGCCAAATCTAGTATGACATCTAACGAGAGGAAACTCGCGGGTCTC
TGTCCATTAAATGCCAAGGAAGTAACAAGACTGCTTAGAGCTCTTGGAGCACCAAGAGATGCGAGGATCTATTGGGCGGG
AGGTGAACCGCTTGGCGGAAAGGAAGCTTTGAAACCGTTAACAAGTGAATTCCCACATCTCTACAACAAATATGATATTG
CGTTGCCTCTTGAACTCAAACCTTTCGCAAAACGAGCTTCGATAATGGCAGCAATCGACTATATAGTGTGTAAGGAGAGT
GATGTGTTTATGGCATCTCATGGAGGGAACATGGGCCACGCAATTCAGGGGCACAGGGCTTATGAAGGACACAAGAAGAT
TATAACACCAAACAAAAGGCATATGCTCCCATACTTTGTGAACTCATCAATGACTAAAACAGAGTTTGAGAAGATGATAA
AGAAATTACACAGACAATCTCTAGGACAGCCAGAACTAAGGATTAGCAAAGCTGGAAGAGATGTTACAAAGTATCCTGTT
CCTGAGTGTATGTGCAATCAATCCAACACCACTATTTAG