Details for Lyrate rockcress Locus 16058178

Position : sca3 ( 5`- 2544850 .. 2542835 -3` )
Annotation : [B2G] dnaj heat shock n-terminal domain-containing protein
External links : CoGe
PGDD synteny : 16058178

Protein [Map View]
MSINRDEALRAKDLAEGLMKKTDFTAARKLALKAQKMDSSLENISRMIMVCDVHCAATEKLFGTEMDWYGILQVEQIAND
ILIKKQYKRLALLLHPDKNKLPGAEAAFKLIGEAQRILLDKEKRMLHDIKRKSLRMPAPAPPYKTQQMPNYHTQPVFRAS
VSTRNIFTELRPENRHPFQKAQAQPAAFSHPTTFWTTCPFCQTRYEYQRAHVNKEVTCRPCIKWFTAFEEPLQSAPPAKG
PCQTTYSFPQQSKFSDQRACSEPHKRSENLPTVSSSKASFPMPGSTAKINGKRKRKNMVECSESSSDSESSSESEDVTMA
AQDLGANGGEQPRRSVRSKQKVSYNENLSDDDVDLVNHNGKGSGKNIDTEREEETKEEKQKNEDHSSTESVDMKGKIKVD
QVVTPSGASDSEEDLSSGSAEKPNLINYDDPDFNEFDKLREKSCFQAGQIWAVYDEEEGMPRFYALIRKVTTPDFMLKYV
WLEVDQDQENETPKLPVSVGKFKVGNMEETNECSIFSRLVYSTTRIRGRKFTVFPKKGETWALFKNWDINSSADSVSPIK
YEYEFVEILSDHAEGATVSVGFLSKVKGFNCVFCPMPKDESDTCEIPPHEFCRFSHSIPSFRLTGTEGRGVTKGWYELDP
AALPVSVSQNLSGDEAAQDRDHQCPPSGFAS*

DNA
ATGAGTATCAACAGAGATGAGGCTCTTAGAGCCAAAGATCTAGCGGAGGGTTTGATGAAAAAGACTGACTTTACTGCTGC
TCGTAAGCTTGCATTGAAGGCTCAAAAAATGGATTCCAGCCTGGAGAACATATCTCGTATGATAATGGTGTGTGATGTTC
ACTGTGCTGCAACAGAGAAGCTGTTCGGAACTGAGATGGATTGGTACGGTATACTTCAGGTTGAGCAGATCGCTAATGAT
ATTCTCATCAAGAAACAGTACAAGAGGCTTGCGCTTCTTCTCCACCCTGATAAAAATAAGCTTCCGGGTGCTGAAGCTGC
TTTTAAATTGATTGGTGAAGCCCAGAGGATTCTTTTGGACAAAGAGAAAAGGATGCTTCATGACATTAAACGCAAAAGTT
TGAGAATGCCTGCACCTGCACCGCCATATAAAACCCAACAGATGCCGAATTATCACACACAACCTGTTTTTCGGGCAAGC
GTCAGTACGAGGAACATCTTCACTGAATTGAGACCTGAAAACAGGCATCCTTTCCAGAAAGCTCAAGCCCAACCAGCTGC
TTTCAGTCACCCTACAACCTTTTGGACCACTTGTCCATTCTGCCAGACGAGGTATGAATATCAACGGGCACATGTCAACA
AGGAAGTCACTTGTCGCCCTTGTATTAAATGGTTCACTGCTTTTGAAGAACCTTTGCAGAGTGCACCACCGGCGAAAGGG
CCATGTCAGACTACTTATTCCTTCCCACAACAGAGCAAATTTTCAGACCAAAGGGCTTGCAGTGAACCACACAAGCGTTC
AGAGAATCTTCCTACTGTCTCCTCTAGCAAGGCGAGTTTCCCTATGCCGGGTTCTACTGCAAAAATCAATGGGAAGAGGA
AGAGAAAGAATATGGTTGAATGTAGTGAAAGCAGCTCTGACAGTGAAAGTAGCAGTGAGTCAGAAGATGTGACTATGGCA
GCACAAGATTTGGGGGCCAATGGAGGAGAGCAACCTCGGAGGTCAGTCCGTAGCAAGCAGAAGGTTTCCTATAATGAGAA
TTTGAGCGATGATGATGTAGACTTAGTCAACCACAATGGGAAAGGGTCCGGAAAAAACATAGATACTGAAAGGGAAGAAG
AGACAAAGGAGGAAAAGCAGAAAAATGAGGATCATAGCTCTACTGAAAGCGTAGACATGAAGGGGAAGATAAAAGTTGAC
CAGGTGGTAACCCCTTCTGGTGCGAGTGATTCAGAGGAAGATTTAAGTTCAGGGAGTGCAGAAAAACCAAATTTGATCAA
CTATGATGATCCTGATTTCAACGAGTTCGATAAGTTGAGGGAAAAAAGCTGTTTTCAAGCTGGCCAGATCTGGGCTGTGT
ATGATGAAGAAGAGGGGATGCCTAGATTTTATGCTCTCATAAGAAAAGTGACAACTCCGGATTTCATGCTTAAGTACGTA
TGGTTAGAGGTAGATCAAGATCAAGAGAATGAAACACCAAAGTTGCCCGTCTCTGTTGGTAAGTTTAAAGTTGGGAATAT
GGAGGAGACGAATGAGTGTTCCATTTTCTCTCGTTTGGTCTACAGCACAACAAGAATCAGGGGTCGCAAGTTTACGGTAT
TCCCAAAGAAAGGAGAAACATGGGCCCTTTTCAAGAACTGGGACATCAACAGCTCCGCTGACTCAGTTTCTCCTATTAAG
TACGAGTATGAATTTGTTGAGATCCTGTCTGATCATGCAGAGGGAGCCACGGTGTCAGTTGGGTTCTTGTCTAAAGTGAA
AGGCTTTAATTGTGTTTTCTGTCCGATGCCGAAGGATGAGTCAGACACTTGTGAGATTCCACCTCATGAATTCTGTAGAT
TCTCACATAGCATTCCGTCATTCAGATTAACAGGAACAGAAGGAAGAGGCGTAACCAAGGGTTGGTATGAGCTTGACCCA
GCTGCTTTACCAGTCTCCGTCTCTCAAAATCTATCAGGAGATGAAGCAGCTCAAGACCGAGACCATCAATGTCCACCTTC
AGGATTTGCCTCTTGA