Details for Lyrate rockcress Locus 16058144

Position : sca3 ( 5`- 7278184 .. 7278528 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058144

Protein [Map View]
MSRASTTVVIYNDLGGGLPLRYHCKSGDDDLGDRSLAPGGSWSFGFTPDIFGRTLFFCSFSWGNESHKFDIYKQSRDKEF
QEFGCKKCEWKIRKNGPCKLNGKTGVFDGCFPWD*

DNA
ATGTCCCGAGCCTCGACGACTGTAGTGATTTATAATGATCTTGGAGGTGGTTTGCCACTACGGTACCACTGCAAATCAGG
GGACGATGATCTTGGAGACCGGAGTTTAGCACCAGGTGGATCGTGGTCGTTTGGATTTACTCCGGATATCTTCGGCAGGA
CTTTGTTTTTCTGTAGCTTTAGTTGGGGAAATGAGAGTCATAAATTTGATATCTACAAACAGAGTAGAGACAAAGAATTT
CAAGAGTTTGGCTGCAAAAAATGCGAATGGAAAATACGGAAAAATGGACCTTGCAAGTTGAATGGGAAGACCGGCGTGTT
TGATGGTTGCTTTCCTTGGGATTAA