Details for Lyrate rockcress Locus 16058134

Position : sca3 ( 5`- 2687157 .. 2689195 -3` )
Annotation : [B2G] botrytis- myb domain protein 108
External links : CoGe
PGDD synteny : 16058134

Protein [Map View]
MDEKGRTLKNNNMEDEMDLKRGPWTAEEDFKLMNYIATNGEGRWNSLSRCAGLQRTGKSCRLRWLNYLRPDVRRGNITLE
EQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDTMKYLWMPRLVERIQSASASAAA
AATTTTTNTTGSAGTSSCITTSNNQFMNYDYNNNMGQQYGVMSNNDYITPENSSVAVSPASDLTEYYSAPNPNPEYYSGQ
MGNSYYPDQNLVGSQLLPENYFDYNGLLDEDLTTMEEQSNLNWFENINGAASSSDSLWNIGETDEDFWFLQQQQHLNNNG
SF*

DNA
ATGGATGAAAAAGGAAGAACCTTGAAGAACAACAACATGGAAGACGAGATGGACCTAAAGAGAGGTCCGTGGACTGCTGA
AGAAGATTTTAAGCTCATGAATTACATTGCTACTAATGGAGAAGGTCGATGGAACTCTCTTTCTCGTTGCGCCGGACTCC
AACGTACCGGTAAAAGCTGTAGACTACGGTGGTTAAACTATCTCCGCCCTGACGTCCGCCGAGGAAACATTACACTCGAA
GAACAACTCTTGATCCTCGAACTTCATTCCCGTTGGGGCAATAGATGGTCAAAAATCGCACAATATTTACCGGGAAGAAC
GGACAACGAGATCAAGAACTACTGGAGGACGCGAGTGCAAAAGCATGCGAAACAGTTGAAATGTGACGTGAACAGCCAAC
AATTCAAAGACACAATGAAGTACTTGTGGATGCCTCGGCTAGTCGAGAGGATCCAGTCAGCCTCGGCCTCAGCCGCAGCA
GCAGCCACCACTACAACCACCAACACCACGGGTTCAGCCGGCACGTCATCTTGCATCACAACCTCTAACAATCAATTCAT
GAATTACGACTACAACAACAACATGGGACAACAGTATGGTGTGATGAGCAACAATGATTATATCACGCCGGAAAATTCCA
GCGTTGCAGTGTCTCCGGCGTCAGACTTGACGGAGTACTACAGCGCTCCAAACCCGAACCCGGAATACTATTCGGGTCAA
ATGGGGAATAGTTATTATCCGGATCAGAATTTGGTGGGTTCACAATTATTACCGGAGAATTATTTCGATTACAATGGATT
ATTAGACGAAGATCTAACGACTATGGAAGAGCAGAGTAACCTCAACTGGTTTGAAAACATTAATGGTGCTGCTTCTTCGT
CAGACAGTTTATGGAACATTGGAGAAACTGATGAAGACTTCTGGTTCTTACAGCAGCAACAACATCTCAACAATAATGGT
AGCTTCTGA