Details for Lyrate rockcress Locus 16058111

Position : sca3 ( 5`- 6459818 .. 6460095 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058111

Protein [Map View]
MGSRGIINDKWSMRILWGCAIGSAIGLYMVAVERQTQNRARAMAESLRAAESQGDGDSV*

DNA
ATGGGATCGAGAGGAATTATCAACGATAAGTGGTCAATGAGGATTTTATGGGGTTGTGCTATCGGAAGTGCAATTGGTTT
ATACATGGTTGCTGTAGAAAGACAAACTCAGAACAGGGCTCGTGCTATGGCTGAGAGTTTGAGAGCTGCTGAGTCACAAG
GTGATGGTGATAGTGTCTAA