Details for Lyrate rockcress Locus 16058105

Position : sca3 ( 5`- 3449337 .. 3447537 -3` )
Annotation : [B2G] atpk19 atpk2
External links : CoGe
PGDD synteny : 16058105

Protein [Map View]
MVSSQCPVANKNQTGKPFQKQLYLSISPPKSVLNDNLELEFSDVFGPMPEANSGEASDVAYDEPAVVYSRSHSLVGPSLV
VSHSLKLNKLTLRETEDSVDLVECVEGESIKENDEFFGNDDTDSDKALEEVSGVVGIEDFEVLKVVGQGAFGKVYQVRKK
DTSEIYAMKVMRKDKIVEKNHAEYMKAERDILTKIDHPFIVQLKYSFQTKYRLYLVLDFINGGHLFFQLYHQGLFREDLA
RVYTAEIVSAVSHLHEKGIMHRDLKPENILMDVDGHVMLTDFGLAKEFEENTRSNSMCGTTEYMAPEIIHGKGHDKAADW
WSVGILLYEMLTGKPPFLGSKGKIQQKIVKDKIKLPQFLSNEAHALLKGLLQKEPERRLGSGPSGADEIKQHKWFKVINW
KKLEAREVQPSFKPAVSGRQCIANFDKCWTEMSVLDSPASSPNSDPKANPFSNFTYVRPPPSFLHRTTSNL*

DNA
ATGGTTTCCTCTCAGTGTCCTGTTGCAAACAAAAACCAGACTGGGAAGCCGTTTCAGAAACAGCTATATTTATCCATCAG
CCCTCCAAAATCCGTCTTGAATGATAACCTTGAGCTTGAATTCTCTGACGTGTTTGGTCCAATGCCTGAAGCTAACTCTG
GAGAGGCCAGTGATGTTGCTTACGACGAGCCTGCTGTTGTCTACAGTCGATCCCACTCGTTGGTGGGCCCGTCTTTGGTT
GTTAGCCATTCTTTGAAGTTGAACAAGCTCACTTTACGAGAGACTGAGGACTCCGTTGACTTGGTGGAGTGTGTTGAAGG
TGAATCTATTAAAGAAAACGATGAATTCTTTGGTAATGATGACACCGACAGTGACAAAGCTCTAGAGGAGGTCTCAGGTG
TAGTAGGCATTGAGGACTTTGAGGTATTGAAGGTTGTGGGGCAAGGTGCATTTGGGAAAGTGTACCAGGTGAGGAAAAAA
GACACTTCTGAGATATACGCGATGAAGGTTATGAGAAAAGACAAGATTGTTGAGAAGAATCATGCTGAATACATGAAAGC
CGAGCGCGATATTCTAACCAAAATCGATCATCCTTTCATTGTCCAACTTAAATACTCTTTTCAGACCAAGTACAGGTTGT
ATCTTGTGCTCGACTTTATAAATGGAGGTCATCTTTTCTTCCAGCTCTATCACCAAGGGCTTTTCAGAGAGGACTTGGCT
CGTGTGTACACTGCAGAAATCGTCTCTGCAGTTTCCCATCTCCATGAGAAAGGCATAATGCATAGAGATCTGAAACCTGA
AAACATACTCATGGACGTAGATGGCCATGTGATGTTAACTGATTTTGGTTTAGCAAAGGAATTTGAAGAAAACACAAGAT
CAAACTCCATGTGTGGGACTACGGAGTATATGGCCCCTGAAATTATTCATGGAAAAGGACATGATAAGGCTGCCGACTGG
TGGAGCGTAGGGATCCTTCTGTATGAGATGCTCACTGGAAAGCCGCCGTTTCTCGGGAGCAAAGGAAAGATACAGCAGAA
AATCGTAAAGGACAAGATCAAGCTTCCACAGTTTCTGTCTAATGAAGCTCATGCCTTGCTAAAAGGGCTGCTGCAAAAAG
AGCCAGAAAGGAGACTGGGAAGTGGACCGAGCGGAGCAGATGAAATAAAACAGCACAAATGGTTCAAGGTGATAAACTGG
AAGAAGCTGGAGGCTAGAGAAGTACAACCAAGTTTCAAGCCAGCAGTTTCGGGAAGACAATGCATAGCAAATTTTGACAA
GTGTTGGACTGAAATGTCTGTGTTGGATTCTCCAGCAAGCAGTCCCAATTCTGATCCTAAGGCCAACCCTTTTTCTAACT
TCACATACGTCAGGCCTCCTCCCTCATTCCTTCACCGAACCACATCCAACTTGTAG