Details for Lyrate rockcress Locus 16058100

Position : sca3 ( 5`- 5764377 .. 5763427 -3` )
Annotation : [B2G] apg12 apg12b
External links : CoGe
PGDD synteny : 16058100

Protein [Map View]
MATESPNSVRKIVVHLRATGGASILKQSKFKIAGTEKFAKVIDFLRRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGFD
GKLVVNYACSMAWG*

DNA
ATGGCGACGGAATCTCCGAATTCTGTTCGGAAAATTGTTGTTCATCTAAGAGCTACTGGTGGTGCTTCAATCTTGAAACA
ATCTAAATTCAAGATTGCAGGGACTGAAAAATTTGCTAAAGTGATTGATTTTCTAAGACGGCAGCTTCACTCTGACTCAT
TGTTTGTTTATGTAAACAGCGCTTTCTCGCCTAACCCCGATGAGTCAGTAATTGATCTATACAATAACTTTGGGTTTGAT
GGTAAACTGGTGGTTAACTATGCTTGTTCCATGGCATGGGGTTAA