Details for Lyrate rockcress Locus 16058084

Position : sca3 ( 5`- 9508458 .. 9506721 -3` )
Annotation : [B2G] hypothetical protein ARALYDRAFT_318885 [Arabidopsis lyrata subsp. lyrata]
External links : CoGe
PGDD synteny : 16058084

Protein [Map View]
MLTYNTMMVIYKAAPIAIIAILIALFWISRMLCGKNSQTSSTVTPQRLIEFSMEELRQATNNFDLDNNHLGFGCYGLVYT
GLIGDRIVAIKREWLHLQPRFLDEVSYMSKIQHENLVNLIGYCCEEGNQLLVFEYMVKGNVRDYLGDSSDFTFKKRISVA
LDAAKGLLHLHNLDPPVQHKRFRTGKVLLDADLNAKVSDAGMLGLLQDRDLRLLNPRGGLEETIDVYSFGLFLLELITGE
KPGLLQSTFEIMQWILLRRSTNTLLDDNMPGTFTNQSLEAYMKITIECLTYPAIDRPKMDMVVTELETIYQNEVINEEHE
VALGSELFNITIQ*

DNA
ATGTTGACGTATAACACAATGATGGTTATCTACAAAGCTGCACCAATTGCGATCATAGCGATTCTAATCGCTCTCTTCTG
GATTTCCAGAATGCTGTGTGGCAAAAACTCCCAGACCAGTTCAACCGTGACGCCACAACGCCTGATTGAGTTCTCGATGG
AGGAATTAAGGCAAGCAACGAACAATTTCGACCTGGATAATAATCATCTTGGGTTTGGATGTTACGGATTAGTTTATACT
GGGCTGATCGGAGACAGGATCGTTGCGATCAAAAGGGAGTGGCTTCATCTCCAGCCTAGATTCTTGGATGAGGTTTCTTA
CATGTCTAAAATCCAGCATGAAAATTTGGTTAATCTGATCGGTTATTGTTGCGAAGAAGGGAACCAATTGCTCGTCTTTG
AGTATATGGTCAAGGGTAACGTGCGAGATTATCTTGGTGATTCTAGTGACTTCACGTTCAAGAAAAGGATATCTGTAGCT
CTTGATGCAGCCAAAGGGTTGCTACACTTGCACAACTTAGATCCTCCAGTACAACACAAGAGATTTAGGACGGGTAAAGT
TTTGCTTGATGCCGACCTCAATGCCAAGGTATCGGATGCGGGAATGTTGGGACTGCTTCAAGATCGTGATCTTCGTCTCC
TTAATCCAAGAGGTGGTTTAGAGGAGACCATTGATGTGTATAGCTTCGGGTTGTTCCTTCTAGAGCTTATCACTGGTGAA
AAACCTGGACTGTTACAATCAACCTTTGAAATTATGCAATGGATACTTCTGCGACGTTCTACAAACACACTTTTGGATGA
TAATATGCCTGGAACGTTCACGAACCAATCGTTGGAGGCTTATATGAAGATTACTATAGAATGCTTGACATATCCCGCGA
TAGATCGCCCGAAGATGGATATGGTTGTGACCGAGCTTGAGACGATTTACCAGAATGAAGTCATCAATGAAGAGCATGAG
GTTGCTCTAGGAAGTGAGCTTTTTAACATAACCATTCAGTGA