Details for Lyrate rockcress Locus 16058074

Position : sca3 ( 5`- 3227291 .. 3230525 -3` )
Annotation : [B2G] set domain-containing protein
External links : CoGe
PGDD synteny : 16058074

Protein [Map View]
MAKACVLQSTLLPAYSPLHKLRNQNFTLSFPPLPVSRCRPGIHCSVSAGETTTRSVEEAPEISWGCEIDSLENATSLQNW
LSDSGLPPQKMAIDRVDIGERGLVASQNLRKGEKLLFVPPSLVISADSEWTNPEAGEVMKRYDVPDWPLLATYLISEASL
QKSSRWYNYISALPRQPYSLLYWTRTELDMYLEASQIRERAIERITNVVGTYEDLRSRIFSKHPHLFPKEVFNDETFKWS
FGILFSRLVRLPSMDGRFALVPWADMLNHNCEVETFLDYDKSSKGVVFTTDRPYQPGEQVFISYGNKSNGELLLSYGFVP
REGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFPVRITGWPMELMAYAYLVVSPPDMGNNFEEMAKAASNKT
STKTDLKYPEIEEDALQFILDSCETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRR
RLRDIRSGELKALRLFSGLRNFFK*

DNA
ATGGCAAAAGCTTGTGTCTTGCAGTCTACTCTCCTCCCAGCTTACTCTCCACTTCACAAACTCCGTAATCAAAACTTCAC
CCTCTCTTTCCCACCGCTTCCGGTGTCCCGATGCCGTCCCGGAATCCACTGCTCAGTTTCGGCCGGTGAGACCACGACAC
GATCCGTGGAGGAAGCTCCGGAGATATCATGGGGCTGCGAGATAGATTCACTTGAGAACGCTACTTCTCTTCAGAACTGG
CTCTCTGATTCAGGTCTCCCTCCGCAGAAAATGGCCATTGATAGAGTCGACATCGGTGAGCGAGGCCTCGTCGCTTCACA
GAATCTCAGAAAAGGAGAGAAATTGCTCTTCGTTCCTCCTTCTCTCGTCATCAGTGCTGATTCCGAATGGACTAACCCAG
AAGCTGGTGAAGTGATGAAACGTTATGATGTTCCAGATTGGCCTTTACTTGCCACTTATCTTATAAGTGAAGCAAGTCTT
CAGAAAAGTTCAAGATGGTATAACTATATCTCTGCTCTTCCACGACAACCTTACTCACTTTTGTACTGGACTCGGACTGA
GCTTGATATGTACTTGGAAGCTTCGCAGATTCGAGAACGGGCGATTGAAAGAATCACCAATGTTGTTGGAACTTATGAAG
ATCTAAGAAGCAGGATATTTTCCAAACACCCTCACCTTTTCCCTAAAGAGGTTTTCAATGATGAGACATTTAAGTGGTCT
TTTGGAATCCTATTCTCACGGTTGGTACGGTTGCCGTCTATGGATGGCAGATTTGCCTTAGTTCCTTGGGCAGATATGCT
TAATCATAATTGTGAGGTTGAGACGTTCCTGGATTATGATAAGTCTTCAAAAGGAGTTGTATTTACAACAGATCGACCAT
ATCAACCAGGTGAGCAGGTTTTCATATCGTATGGGAATAAATCTAACGGAGAGCTATTATTATCTTATGGGTTTGTTCCC
AGAGAAGGAACCAATCCTAGTGATTCAGTAGAACTAGCATTGTCACTGAGGAAAAACGATAAGTGTTACAAGGAAAAGCT
GGATGCTTTAAAGAAACACGGATTATCCACACCTCAATGCTTCCCCGTAAGGATAACAGGTTGGCCAATGGAGCTAATGG
CATATGCTTATCTAGTGGTGAGCCCTCCAGATATGGGAAACAACTTTGAAGAGATGGCGAAAGCTGCTTCAAATAAGACC
TCAACAAAGACTGATCTAAAATATCCTGAAATCGAGGAAGATGCATTGCAGTTCATACTGGACTCATGTGAAACAAGCAT
ATCAAAGTACAGCCGATTTTTAAAGGAAAGTGGATCAATGGATTTGGACATAACATCTCCAAAACAGTTGAACCGAAAAG
CGTTTCTGAAACAGCTAGCTGTAGACTTGTCCACTAGCGAGCGCAGGATACTGTACCGTGCACAATACATTCTGAGGAGG
AGACTGAGAGATATTAGAAGTGGTGAGCTGAAGGCTCTACGGCTCTTCAGTGGACTTAGGAACTTCTTCAAGTGA