Details for Lyrate rockcress Locus 16058049

Position : sca3 ( 5`- 873357 .. 871993 -3` )
Annotation :
External links : CoGe
PGDD synteny : 16058049

Protein [Map View]
MASNLLKALIRSQILPSSRRNFSVATTQLGIPTDDLVGNHTAKWMQDRSKKSPMELISEVPPIKVDGRIAACEGDTNPAL
GHPIEFICLDLDEPAICKYCGLRYVQDHHH*

DNA
ATGGCGTCAAATCTCCTGAAAGCCCTAATCCGATCGCAGATTCTTCCATCTTCGAGGAGGAATTTTAGTGTGGCGACCAC
ACAACTCGGCATTCCAACAGACGATCTAGTCGGCAATCACACCGCCAAATGGATGCAGGATAGAAGCAAGAAATCACCTA
TGGAACTGATCAGTGAGGTTCCACCTATCAAAGTTGATGGAAGGATTGCTGCTTGTGAAGGAGACACCAATCCGGCCCTG
GGTCATCCAATCGAGTTCATATGCCTCGACCTAGATGAGCCTGCGATCTGCAAGTACTGCGGCCTTCGCTATGTTCAAGA
TCATCACCACTAA